Alignment for family M29

Go to full screen view Go to full-width version
               1              2          3                4       
      1234567890123456ABCDE7890A12345678901234ABCDE5AB678901234567
                                                                  
                                                                  
    1 ---FQEKQQEYARLIV-----ENGA-AIQKGQELVLRCPA-----E--CWEFGRMIVKAG
    2 ---FQEKQQEYARLIV-----ENGA-AIQKGQELVLRCPA-----E--CWEFGRMIVKAG
    3 ---HQEKLSQYARLIV-----KTGA-NVQNDQLVLINCAV-----E--NFEFGRMVVAEA
    4 --SFETKQQNLADLAV-----ALGV-NLQEGQTLIINAPI-----D--CADFAHKVAAAA
    5 -----ENLQKLAKLAV-----RIGV-NIQKDQNLVVNSPI-----E--CSEFARALAEEA
    6 ------SLGKYAQLIV-----KTGL-NLQENQTLVISAPI-----E--CALFTRIVAEKA
    7 M--NRNSLEKYAQLIV-----KTGL-NLQKNQTLVISAPI-----E--SAPFTRLVTEKA
    8 -------LEKYAHLIV-----KTGI-NLQDKQTLVISAPL-----E--SAPFTRLVAEKA
    9 ------SLEKYALLIV-----RTGL-NLQPNQTLVIFSPI-----E--CAPFTRLVAQTA
   10 M--DLSTLEKYARLIL-----QVGL-NLRKDQTLFINSPI-----E--CAPITREIAEAA
   11 -------LDKYARLVV-----KTGI-NLQPKQILVIKSPI-----E--CAEFTRKISEIA
   12 -------LDKYARLVI-----KAGI-NLQPKQILVIKSPI-----E--CAEFTRKISEIA
   13 -------LEKYAQLVV-----KSGV-NLQPNQIFVIRSPI-----E--CAEITRKIAKIA
   14 -------MEKYASLIV-----QIGV-NIQPGQTLVINSPI-----E--CAAFTRLVAQQA
   15 -------LEKYSQIIV-----KTGL-NIQQNQILVINSPI-----E--CGDFTRTISEIA
   16 M--NKNYLENYSKIVV-----KSGL-NIQDDQILVINSPI-----E--CAEFTRLISEVA
   17 M--TQNKLEKYARLLV-----KTGI-NIQKGQTLVINSPI-----E--TAEFARMIAEHA
   18 LLINKNLLKKYAELAV-----KIGV-NIQKDQLLVISSPI-----E--CAYFSRLIAEIA
   19 MNKFESMLENYAKLAT-----HIGV-NVQEGQTLVISSPV-----E--CAEFTRMLVKSA
   20 -------IEKYVELAV-----KIGI-NLQQGQILVINSPV-----E--TADFTRKIVEAA
   21 -------IEKYVELAV-----KIGI-NLQQGQILVINSPV-----E--TADFTRKIVEAA
   22 -------IEKYIELAI-----KIGI-NLQKGQILVINSPV-----E--TADFTRKLVEAA
   23 -----KQIENYVELTI-----RKGV-NIQKGQILVINSPV-----E--TYDFTRKLVEKA
   24 MNDFKKLLEKYADIAI-----KIGI-NIEPNQTLVINSPI-----E--CAEFVRIIANKA
   25 MNDFKKLLEKYADIAI-----KIGI-NIEPNQTLVINSPI-----E--CAEFVRIIANKA
   26 KN-----LEKYAKLLV-----RNGL-NIQKDQLLVVNAPI-----E--AAEFVRIVAKQA
   27 -------LEKYAELVV-----KTGI-NLQEKQQLFITSPI-----E--CADFARIMAEKA
   28 ------ILRKYAELVV-----KKGI-NLQDKQQLLINSPI-----E--CAEFARLIAEEA
   29 -------LRAYADLVV-----RVGV-NLQKDQILVINAPI-----E--CAAFARMIAQQA
   30 ------LLKKYAELVV-----RVGV-NIQKDQILVINTPI-----E--CAEFAREISKAA
   31 ------LLEEYARLIV-----RMGV-NLQADQPLVINAPL-----A--CADFARRVAGAA
   32 ----TDLLKKYAALVV-----RVGV-NLQKNQPLVIHAPI-----T--CADFVHALTSEA
   33 ----TDLLKKYAALVI-----RVGV-NLQKDQPLVIHAPI-----T--CADFVHALTSEG
   34 M--NTNLLRKYAALVV-----RVGV-NLQEDQPLVIHAPI-----A--CADFVHALAEEG
   35 M--NTNLLRKYAALVV-----RVGV-NLQEDQPLVIHAPI-----T--CADFVHALAAEG
   36 -------LKKYASLVV-----RVGV-NLQENQPLVIHAPI-----A--CADFVHTLAKEA
   37 -------LKKYAPLVV-----RVGV-NLQENQPLVIHAPI-----A--CADFVHTLAKEA
   38 -------LKKYAALVV-----RVGV-NLQPSQPLVIRAPI-----G--CAAFVRALSAEA
   39 -------LKKYAALVV-----RVGI-NLQPSQPLVIRAPI-----G--CAAFVRALSAEA
   40 -----NLLSKYAKLAI-----IKGV-NIQKDGLLVINSPI-----E--CSNFARLLADEA
   41 -----DLLSKYAKLAA-----LKGI-NIQKNKMLVINSPI-----E--CSEFARMIAEEA
   42 -----DLLRKYAKLTV-----NKGV-NLQKDGILVINSPI-----E--CYDFARLMAEEG
   43 ---------KYATLAV-----KKGV-NLQKDQVLLVNSPV-----E--CIDFARAIAEVA
   44 ------NLYKYAKLVV-----EVGV-NVQKDQVLVIRTPI-----E--GATFARAMTECA
   45 ----EEKFKEYAALLI-----RVGL-NVQKGQTLVISSPV-----E--CAWFARMCAAEG
   46 ---FQNNLMKYADLAV-----RIGV-NLQAGQTLVINAPI-----E--SADFVRIVAERA
   47 MISKETKLERYADLLI-----RVGL-NIQKGQTLLINAPI-----K--QSDFVAQLSEKA
   48 MENFEKLLDHYADITV-----NVGL-NVQKDQEVMIFAPI-----E--SPEIVRKVVKKA
   49 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   50 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   51 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   52 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   53 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   54 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   55 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   56 ------------------------------------------------------------
   57 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   58 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   59 MS-FEQTLEKYAALAV-----NVGV-NIQPGQTLSISAPL-----E--AVQFVRLVTEKA
   60 --SFEQSLEKYAALAV-----NVGV-NIQPGQTLSINAPL-----E--AAPFVRLITEKA
   61 MS-FEQNLEKYAALAV-----NVGV-NIQPGQTLSINAPL-----E--AAPFVRLVTEKA
   62 MEQFERNIEKYAELAV-----KVGV-NIQKGQVLNINADI-----S--SADFVREIAKKA
   63 MDSFSQKLNTYAQLAV-----EVGV-NVQKGQHVVVNAST-----D--VRDFVRLIVKHA
   64 MDSFSQKLNTYAQLAV-----EVGV-NVQKGQYVVVNAST-----D--VRDFVRLIVKHA
   65 MDSFSKKLSTYALLAV-----EVGV-NVQKGQHVVVNAST-----E--VRDFVRLIVKHA
   66 MSSFTEKLNTYAQLAV-----EVGV-NVQKGQHVVINAST-----D--VRELVRLLAKHS
   67 MSSFTEKLHTYAQLAV-----EVGV-NVQKGQHVVINAST-----D--VRELVRLLAKHS
   68 MNSFTDKLSKYAKLVA-----EVGV-NVQKGQQVVINAST-----E--VRDFARLLVKSA
   69 MNSFTDKLSKYAKLVA-----EVGV-NVQKGQQVVINAST-----E--VRDFARLLVKSA
   70 MNSFTDKLSKYAKLVA-----EVGV-NVQKGQQVVINAST-----E--VRDFARLLVKSA
   71 MSSFEKQLDQYAKTIV-----EVGV-NVQKEQEVVVSAST-----E--SADLVRLVAKHA
   72 MSQFLQNLEKYAELAV-----KVGV-NVQEGQTLVINAAL-----D--AAEFVRLAVKKA
   73 MSHFQTNLEKYAELAV-----RVGV-NVQKGQTLVINTTL-----D--AAELVRTIVKKA
   74 MSNFLQNLEKYAELAV-----KVGV-NIQKGQTLVVNTSI-----D--SKELVRLIVKKA
   75 MNDFQTNLEKYAELAV-----KVGV-NIQKGQTLVVNAAI-----D--AAQLVRLIVKKA
   76 MENFKQNLEKYADLAV-----KVGV-NVQKGQTLVVNASL-----D--AAEFVRLVVKKA
   77 MELFQTKLEKYAELAV-----KVGV-NIQKGQTLVINAGL-----E--AADFVRLITKKA
   78 --SFEILFDRYADLAV-----KVGV-NVQPMQTLVVTAPL-----S--TAPFVRKVAKKA
   79 ---FEATLTKYAELAV-----KIGV-NIQPNQYLYIAASI-----E--SAPLVQVVTKIA
   80 MTSFNEKLTYYAELAI-----KVGV-NIQPGQQLYIAAAI-----D--SAPFVRLLTQKA
   81 MDHFQTQLSNYAELAV-----KVGV-NIQKDQYLFISAST-----E--ITQFVRLIVEKA
   82 ---FNTKLLKYAELAI-----KVGV-NIQKDQYLYISCST-----D--NLKLAQIITKLA
   83 ---FNTKLLKYAELAV-----KVGV-NIQKDQYLYISCST-----D--NLKLAQIITKMA
   84 --SFDTKLLKYAELTV-----KVGV-NIQKDQYLYISCST-----D--NLKLAQIITKIA
   85 ---FEQNLKKYANLIV-----KVGV-NVQPGQEVYVSAST-----E--VAPLARLVAREA
   86 MKTFDQNLEKYAELIV-----KVGV-NVQPGQEVFVVANT-----E--MTTLARLIARKA
   87 ---FESNLTKYAELIV-----KVGV-NVQENQEVFITGAV-----D--QADLVRLVAEQA
   88 MPVTKQQLEQYAELIV-----KVGV-NIQEGQELFVTCSI-----D--QAELGRLIAAQA
   89 MSDFNTYLDKYAELAV-----KVGV-NIQEGQTLVVHAPV-----D--SAEFTRLIAKKA
   90 MSDFNTYLDKYAELAV-----KVGV-NIQEGQTLVVHAPV-----D--SAEFTRLIAKKA
   91 MSDFNTSLDKYAELAV-----KVGV-NIQEGQTLVVHAPV-----D--TAEFTRLIAKKA
   92 MSDLNTSLHKYAELAV-----KVGV-NIQEGQTLVVHAPV-----E--AADFTRLIAEKA
   93 MSDFQQKLHKYAELAV-----RVGA-NVQPGQTLIVHAPI-----L--SAELVRLIVKSA
   94 MSDFQQKLQKYAELAV-----RVGA-NVHPGQTLIVHAPI-----L--SAELVRLIVKSA
   95 MSDFQQKLQKYAELAV-----RVGV-NVQPGQTLIVHAPI-----L--SAELVRLIVKSA
   96 MSDFQKKLEKYAELAV-----KIGV-NVQPGQNLIINTTI-----D--SAELVRLIVKQA
   97 MSNFQELLSRYAELIV-----KTGV-KIQKGQKLVVNSTI-----D--AAELVRLITKHA
   98 MSSFEQKLERYAELAV-----KVGA-NVQPGQTLVVNAMI-----D--AAPLVRLIVKKA
   99 MSSFEQKLERYAELAV-----KVGA-NVQPGQTLVVNAMI-----D--AAPLVRLIVKKA
  100 MLSFEQKLENYAELAV-----KVGA-NVQPGQTLVVNAMI-----D--AAPLVRLIVKKA
  101 MSSFEQKLERYAELAV-----KVGA-NVQPGQTLVVNAMI-----D--AAPLVRLIVKKA
  102 MSNLQTTMEKYAELAV-----KVGV-NIQKGQTLIVNADI-----A--TAPFVRLVTKKA
  103 MTTFQDNLEKYAELAV-----KVGI-NIQPNQTLIVRTPL-----T--AVDYVRLVAKKA
  104 MTTFQENLEKYAELAV-----KVGV-NIQPGQTLVIRTPI-----S--ALELVRLVAKKA
  105 --SFQEKVENYANLAV-----RVGV-NIQKGQTLFVRAPL-----F--AADFVRLVAKKA
  106 MTTFDEKLEKYAELAV-----KIGI-NVQEGQTLVVNAPI-----S--SADFVRLVAKKA
  107 MTTLDQKIEQYAELAV-----TVGV-NIQKDQTLVLNAPV-----A--SADFVRLVAKKA
  108 MTVLSEKLEKYAELIV-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  109 MTVFSEKLEKYAELIV-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  110 -------------MIV-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  111 ------------------------------------------------------------
  112 MTVFSEKLEKYAELIV-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  113 ------------------------------------------------------------
  114 MTVFSEKLEKYAELIV-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  115 MTVFSEKLEKYAELIV-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  116 MTVFSEKLEKYAELII-----KVGV-NVQPEQKVVIMAPV-----D--AAPLVRLISKYA
  117 MATFEENLKKYAKLIV-----EVGV-NVQPDQKVVVNATL-----E--NAPLARLITAFA
  118 MAKFNEKLDKYAELIV-----KVGV-NVQPNQKVVIASSI-----E--SAPLTRLITKHA
  119 ---------RYAELAV-----KKGV-NIQPGQQLEVRADI-----S--QAPLVRHVVKAA
  120 ----QEQLKKYAALAV-----RTGI-NLQAGQQLEIRAGI-----E--NAPLVREITRVA
  121 MNRWEKELDKYAELAV-----KVGV-NIQPGQTLFVNAPL-----E--AAPLVRKIAKTA
  122 MNRWEKELDKYAELAV-----KVGV-NIQPGQTLFVNAPL-----E--AAPLVRKIAKTA
  123 MNRWEKELDKYAELAV-----KVGV-NIQPGQTLFVNAPL-----E--AAPLVRKIAKTA
  124 MDRWENELHKYAELAV-----KVGV-NIQPGQTLFVNAPL-----E--AAPLVRKIAKTA
  125 MDRWENELHKYAELAV-----KVGV-NIQPGQTLFVNAPL-----E--AAPLVRKIAKTA
  126 MNRWEKELDKYAELAV-----KVGV-NIQPGQTLFVNAPL-----E--AAPLVRKIAKTA
  127 MERWENELNKYAELAV-----KVGV-NVQPGQTLFVSAPL-----D--AAPLVRKIAKTA
  128 MERWENELNKYAELAV-----KVGV-NVQPGQTLFVSAPL-----D--AAPLVRKIAKTA
  129 MNNWEQNLEKYAALAV-----QVGV-NVQKGQTLFVNAPL-----E--AAPLVRKIARKA
  130 MNNWEQNLEKYAALAV-----QVGV-NVQKGQTLFVNAPL-----E--AAPLVRKIARKA
  131 MSDWEQNLEKYAALAV-----QVGV-NVQKGQTLFVNAPL-----V--AAPLVRKIAKKA
  132 ----EKQLQKYAELAV-----RVGV-NIQPGQTLFINAPL-----P--SAPLVREIAKKA
  133 MSTFAQKMEKYATLAV-----RVGA-NVQQGQTVVVMAPV-----A--AAELVRLVAVKA
  134 MTANQKQLEKYAELAL-----EKGV-NLQRGQGLIINAPI-----E--AADLVRTISAKA
  135 ---------KYAELAL-----RTGV-NLQKNQALMINAPI-----E--GADFTRIVARKA
  136 ---------KYAELAL-----RKGV-NLQKGQALMINSTI-----E--GAEFTKIVAKKA
  137 MTS-KHTQEKYAELTL-----KKGV-NLQKGQAVMINAPI-----E--GADFTRIVARKA
  138 -----DKLEKYAELAL-----RTGV-NLQEQQKLMINSTI-----E--GAEFTRVVAKKA
  139 -------IEHYAELAV-----KVGV-NVQQGQTLMVTSPV-----S--AADFVRIVARKA
  140 ------DLEKYADLIV-----RTAV-HIQRGQVLWINAPI-----H--TPDLVRLIVKRA
  141 MLTFEQKLNNYADIIV-----KIGA-NIQHGQSVMVNATI-----D--APELVRLVVKKA
  142 -MTFEEKLQAYAELAV-----KVGV-NIQPGQYLLVNTSV-----D--ALDFARLVVKEA
  143 -MTFEEKLQAYAELAV-----KVGV-NIQPGQYLLVNTSV-----E--ALDFARLVVKEA
  144 ---FEEKLQAYAELAV-----KVGV-NIQPGQYLLVNTSV-----D--ALDFARLVVKEA
  145 -MTFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  146 --TFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  147 -MTFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  148 -MTFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  149 -MTFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  150 --TFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  151 -MTFEEKLQAYAELTV-----KIGV-NIQPGQYLLVNTSV-----D--ALDFARIVVKEA
  152 --TFQEKLEQFADLAV-----RIGV-NIQKGQYLLINTST-----D--TLDFTRIVVKKA
  153 ---FQEKLEQYAELTV-----YVGL-NVQKGQFVVINTTT-----D--TLEFTRLVVKKA
  154 MEAFDRSLEKYAELVV-----RVGA-NVQPGQVLHIESPL-----E--AAPFTRKVVQKA
  155 MTSFQKQLEKYAELVV-----KVGV-NIQPGQILYIESPI-----E--SVEFTRHVVRKA
  156 MDNFEKNLEKYAELVV-----KVGV-NVQPGQVLIINAPI-----E--TVELTRRIVAKA
  157 MDNFEKNLEKYAELVV-----KVGV-NVQPGQVLIVNAPI-----E--TLELTRRIVAKA
  158 MDNFEKNLEKYAELVI-----KVGV-NVQPGQVLIVNAPI-----E--TVDLTRHIVAKA
  159 MDNFEKNLEKYAELVV-----KVGV-NIQPGQVLIVNAPI-----E--TADLTRLIVAKA
  160 MNPFESLLEQYAELVV-----RVGV-NIQPGQAMLVTAPL-----E--TVEFTRLIVSKA
  161 MSSFEALLEQYAELVV-----KVGV-NIQHGQVFLVTAPL-----E--TVEFTRLIVNKA
  162 MSSFETLLEQYAELVV-----RVGV-NIQPGQVFLVTAPL-----E--TIDFTRLIVSKA
  163 MSTFESLLEQYAELVV-----KVGV-NIQPGQVFLVTAPL-----E--TVEFTRLIVSKA
  164 ------NLEKYAELAI-----KVGV-NIQPGQILLIKSPI-----E--CADFARNALKEA
  165 -MDFNTKLQKYAELAV-----KTGV-NIQPGQTLLVRTPI-----E--CAEYVRYVVEEA
  166 ------NLDKYAELSI-----KVGM-NVQPGETLLVRSPI-----D--CADFVRKAVKYA
  167 -------IDKFAELAI-----KTGI-NVQSGENLLIRADV-----E--AIDFTRRCVKEA
  168 -------IDKFAQLAI-----KSGI-NVQPGESLLIRADV-----E--SRDFARRCVREA
  169 MRTFAQKLEKYAELAV-----KVGA-NVQEGQEVLLKSPI-----D--AGELARLVAEKA
  170 MEPYKASLKKFAKLAI-----KIGV-NLQPGQGLFLTSPI-----E--AAGFANLVAEEA
  171 ---FNQNLEKYAQLIT-----EVGV-NVQKGHTIVIQIAV-----D--QAPLARLLTKKA
  172 ---FNQNLEKYAQLIT-----EVGV-NVQKGHTIVIQIAV-----D--QAPLARLLTKKA
  173 ---FNQNLEKYAQLIT-----EVGV-NVQKGHTIVIQIAV-----D--QAPLARLLTKKA
  174 LENFNENLKKYARLIA-----ETGV-NVQDNHTVVLQISV-----D--QAPLARLITEEA
  175 LENFNENLKKYARLIA-----ETGV-NVQDNHTVVLQISV-----D--QAPLARLITEEA
  176 LENFNENLKKYARLIA-----ETGV-NVQDNHTVVLQISV-----D--QAPLARLITEEA
  177 ------------------------------------------------------------
  178 LENFNENLKKYARLIA-----ETGV-NVQDNHTVVLQISV-----D--QAPLARLITEEA
  179 LSDFNELLKKYARLIA-----ETGV-ATEKGHTVVLQISV-----E--QAPLARLITQEA
  180 ---FKENLDKYAQLIV-----EMGV-NVKQSHTVVLQINV-----K--QAPLARLITKKA
  181 ---FYQNLETYAQLVV-----EVGV-NVQKGHTIVLSVSV-----D--QAPLARLITEKA
  182 LPNFEENLQKYAHLLV-----KSGI-NVTKGHTVVLQIDV-----D--QAPLARLITKEA
  183 LPNFEENLQKYAHLLV-----KSGI-NVTKGHTVVLQIDV-----D--QAPLARLITKEA
  184 LDNFDQLIKKYANLIV-----TTGI-NVQEGHTVHLSVSV-----D--NAQLGRAITKAA
  185 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  186 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  187 LPNFKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  188 ---FKENLEKYAKLLV-----ANGV-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  189 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  190 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  191 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  192 LPNFKENLEKYAKLLV-----ANGI-NVQPGHTLTLSIDV-----E--QRELAHLIVKEA
  193 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  194 ---FKENLEKYAKLLV-----ANGI-NVQAGHTLALSIDV-----E--QRELAHLIVKEA
  195 LPNFKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  196 ------------------------------------------------------------
  197 ---FKENLEKYAKLLV-----ANGI-NVQPGHTVALNIDV-----E--QRELAHLIVKEA
  198 ---FKENLEKYAKLLV-----ANGV-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  199 ---FKENLEKYAKLLV-----ANGV-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  200 ------------------------------------------------------------
  201 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALSIDV-----E--QRELAHLIVKEA
  202 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALNIDV-----E--QRELAHLIVKEA
  203 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLVLNIDV-----E--QRELAHLIVKEA
  204 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLVLNIDV-----E--QRELAHLIVKEA
  205 ---FKENLEKYAKLLV-----ANGI-NVQPGHTLALNIDV-----E--QRELAHLIVKEA
  206 LPNFKENLEKYAKLLV-----ANGI-NVQPGHTVALNIDV-----E--QRELAHLIVKEA
  207 LPNFKENLEKYAKLLV-----ANGI-NVQPGHTVALNIDV-----E--QRELAHLIVKEA
  208 ---FKENLEKYAKLLV-----ANGI-NVQPGHTVALNIDV-----E--QRELAHLIVKEA
  209 ---FKENLEKYAKLLV-----ANGI-NVQPGHTAALNIDV-----E--QRELAHLIVKEA
  210 ---FKENLEKYAKLLV-----ANGI-NVQPGHTVALNIDV-----E--QRELAHLIVKEA
  211 ---FKENLEKYAKLLV-----ANGI-NVQPAHTVALNIDV-----E--QRELAHLIVKEA
  212 LPNFKENLEKYARLLV-----ANGI-NVQPGHTVALSIDV-----E--QAELAHLLVKEA
  213 ---FKENLEKYAKLLV-----ANGI-NVQPGHTMALSIDV-----E--QAELAHLLVKEA
  214 ---FKENLEKYAKLLV-----ANGI-NVQPGHTVALSIDV-----E--QAELAHLLVKEA
  215 ---FKENLEKYAKLLV-----TNGI-NVQPGHTVALSIDV-----E--QAELAHLLVKEA
  216 LPNFKENLEKYAKLLV-----TNGI-NVQPGHTVALSIDV-----E--QAELAHLLVKEA
  217 ---FKENLAKYAKLLV-----STGI-NVQPGHTVQLTIGV-----E--QAELARLIVKEA
  218 LENFDVNLQKYAKLLV-----STGI-NVQPGHTVVIYAEV-----E--QAPFARLLVKEA
  219 LENFDVNLQKYAKLLV-----STGI-NVQPGHTVVIYAEV-----E--QAVFARLLVKEA
  220 LPNFEQNLQKYAKLLV-----TKGI-NVKQGDWVKVYIAV-----D--QAKLARLVVKEA
  221 ---FKENLEKYANLLI-----TKGV-NIQKGHTLIIAIAV-----E--HHYLASLLTEKA
  222 ---FKENLEKYANLLI-----TKGV-NIQKGHTLIIAISV-----E--HYQLASLLTEKA
  223 ---FQTNLEKYANLLI-----NKGV-NVQKGHTLLIAISV-----E--HHVFARMLTKKA
  224 ------------------------------------------------------------
  225 ---FEHNLEKYANLLI-----KKGI-NVQKGHTLLITIAA-----E--HYRFARLLTKKA
  226 ---FEHNLEKYANLLI-----KKGV-NVQKGHTLLIAIAV-----E--HHQFARLLTKKA
  227 LPDFQKNLEKYADLLI-----RKGV-NVQKGHTLIIAIAV-----E--HYAFAKMLTEKA
  228 LPHFDDYLEKYANLLI-----KKGV-NIQKGHTLLISIAV-----E--HHKFARLLTKKA
  229 ---FNELLEKYADLLI-----KKGV-NIQKGHTLLLTISV-----E--HYDFARLITKKA
  230 LQDFDNLLKKYAQLII-----SKGL-NVQKGHTLALTIDV-----E--QVHLARLLTEAA
  231 LENFETLLKKYADLMI-----HKGI-AVKEGDYVLLNANI-----N--QAPLARLITEAA
  232 ---FDQLLKKYADLLI-----YKGI-NVTEGDYVNIQTDV-----N--SIELTRLLVAAA
  233 ---FDELLAKYAHLLI-----KKGL-NVGTGDYVHINTDV-----N--QIQLTHLLVKQA
  234 MKNFDQLLDKYANLLI-----EKGI-NVQKGDNVMIYIAV-----D--QAPLAHFLAKHA
  235 ---FKEKLQKYAELIV-----KVGV-NVQPNQPVVLYINV-----E--QQELAHLIVKEA
  236 ---FKEKLQKYAELIV-----KIGV-NIQPNQPVVLYINV-----E--QQELAHLIVKEA
  237 ---FEHKLAQYAHLII-----KTGV-NIQPGQTVVLYISV-----T--QQQLAHLIVKEA
  238 --NFSEKLKKYAELIV-----KVGV-NVQKGQPVVLYISV-----T--QQELAHLIVEEA
  239 ------NLKKYAELIV-----KVGV-NVQPGQTVVLYISD-----R--QPEFAHMIVKEA
  240 --DFDERLEKYAELIV-----KTGV-NVQKGQPVILYISV-----D--QAKLARLIVAKA
  241 LSNFNESLKKYAELAV-----DIGV-AVKPGDTVYVQISV-----D--QAQMARLIVEAA
  242 ---FNEKLKQYADLAV-----DIGV-AVKPGDTVYLQIAV-----D--QAPLARLIVAAA
  243 ---FDKSLKQYAELAV-----DIGV-AVKPGDTVYLQIAV-----D--QAKLAQLIVAAA
  244 ---FDKSLKQYAELAV-----DIGV-AVKPGDTVYLQIAV-----D--QAKLAQLIVAAA
  245 LPNFDKSLKQYAELAV-----DIGV-AVKPGDTVYLQIAV-----D--QAKLAQLIVAAA
  246 MTTFQHNLEKYAALVA-----KTGI-NVQPGDTVVLQIAV-----D--QAEFARDMTAAC
  247 MTTFQHNLEKYAALIA-----KTGI-NVQDGDTVVIQIAV-----S--QAEFARDITAAC
  248 MSHFKQQLQQYAELIV-----AVGG-NVQPGQTVMLQIEV-----E--QSELAHLITTAA
  249 ---FDQLLSKYADLIT-----SVGV-NVKPGQDIIIYAEI-----D--QAELVHRIMEAA
  250 ---FDQLLDKYADLIT-----HVGI-NVKPGQDVIIYAEI-----D--QADLVHRIMHAA
  251 ---------KYADLIT-----SVGV-NVQKGQDIVIYADV-----A--QVPLVHKIVDSA
  252 -------LKKYADLII-----SIGV-NVQPGQDVIIYADI-----D--QQKLAHFVLDAA
  253 ------------------------------------------------------------
  254 -------LNKYAELIV-----KRGV-NVQPGQTIILYASV-----E--SADFARKIVAAA
  255 -------LNKYAELIV-----KKGV-NVQPGQTIILYAAV-----D--EAYFAHKIVAAA
  256 ---------------------------------------V-----D--EAYFARKIVRAA
  257 -------LDKYADLII-----KRGV-NVQPGQTIILYAAV-----D--EAYFARKIVRAA
  258 -------LNKYAELIV-----KKGV-NVQPGQTIILYAAV-----D--EAYFARKIVAEA
  259 ---------------------------------------V-----D--EAYFARKIVAAA
  260 --SFESKLNQYATLIV-----KKGI-NVQSGQTVILYASV-----D--QVVLARKIVNAA
  261 --ALNKQIDKFADLII-----KKGA-HVAPRQTVVIYSNT-----E--TDYFAEKLVKRA
  262 -----QNLLKYAKLIT-----EVGI-NVQPGQKVIIYASV-----T--QKKLVDFITSNA
  263 ----EKNLKKYAQLIT-----RVGV-NVQEGQTIILYASV-----T--QKHLANLITAEA
  264 MNNFEEKLSKYAEVIV-----KIGA-NVQKGQKVWVNCTT-----D--ALPLVYKVTELA
  265 MNNFEEKLNKYAEVII-----KIGA-NVQKGQKVWINCTT-----D--ALPLVYKVTELA
  266 -------LDKYAQVIV-----KIGA-NVQPGQRVWINCTT-----D--SLPLVYKVTEAS
  267 --YKEKQLKQYAALLV-----KVGM-NVQPEQRVYIRATV-----D--AQDFVHLVVEAA
  268 MDNYNEKLRQYAELLV-----KVGM-NVQQNQPVFIRSSV-----E--ALDLTHLIVEEA
  269 MDNYNEKLKQYAELLV-----KVGM-NVQQNQPVFIRSSV-----E--ALDLTHLIVEEA
  270 MANYHEKLQQYAELLV-----KVGM-NVQENQPVFIRSSV-----E--ALELTHLIVEEA
  271 ------------------------------------------------------------
  272 MTNYHNKLKQYAELLV-----RVGM-NVQPQQPVFIRSSV-----E--ALELTHLIVEEA
  273 MTNYHNKLKQYAELLV-----RVGM-NVQPQQPVFIRSSV-----E--ALELTHLIVEEA
  274 ---YQDKLKQYAELLV-----KVGM-NVQQNQPVFIRTSV-----E--TIDLTRLIVEVA
  275 MSNYQDKLRQYAQLLV-----RVGM-NVQDKQPVFIRSSV-----E--ALELTHLVVEEA
  276 MSNYQDKLRQYAQLLV-----RVGM-NVQDKQPVFIRSSV-----E--ALELTHLVVEEA
  277 SLSYNEKLQQYAELLV-----KIGM-NVQPKQPVFIRSSV-----D--AIDLTRLIVEES
  278 MTNYKEKLQQYAELLV-----KVGM-NVQPKQPVFIRSSV-----E--TLELTHLIVEEA
  279 ------------------------M-NVQPKQPVFIRSSV-----E--TLELTHLIVEEA
  280 ------------------------------------------------------------
  281 ---YKEKLQQYAELLV-----KVGM-NVQPKQPVFIRSSV-----E--TLELTHLIVEEA
  282 MKDYKQKLQQYAELLV-----KVGM-NVQPKQPVFIRASV-----E--TLELTHLIVEEA
  283 MSNYQQKLRQYAQLIV-----KVGM-NIQPQQPVFIRSSV-----E--ALELTHLIVEEA
  284 MTNYQHKLQQYAELLV-----KVGL-NVQPEQPVFIRSSV-----E--TLELTHLIVAEA
  285 ------KLKQYAELLV-----GVGM-NVQKDQPVFIRSSV-----D--ALELTHYIVEAA
  286 MTELQDKLQQYAELLV-----GVGM-NVQKDQPVFIRSSV-----D--ALELTHYIVEAA
  287 MTTYQDKLQQYAELLV-----QVGM-NVQEGQPVFIRSSV-----D--ALELTHEIVAAA
  288 MTQLEEKLKQYAQLIV-----DVGM-NVQEGQPVFIRSSV-----D--ALELTHDIVEAA
  289 ----EKRLQQYAKLLV-----RVGM-NVQQGQPVYIRTSV-----E--TVDFTRLIVKEA
  290 --SLQEKISMLAELAV-----KIGV-NVQKGDIVEVQTPV-----E--RVNLAREVVQKA
  291 --SLNDNMKKYADLIV-----KVGS-NVMEGDIVTIKCPV-----E--RDDFGRMLTESA
  292 ------------------------------------------------------------
  293 MENFDKKLNNYARLII-----EKGI-NAN-DRPLVIRCAV-----E--RADFARLLVKYA
  294 ------------------------------------------------------------
  295 MENFDKKLNNYARLII-----EKGI-NAN-DRPLVIRCAV-----E--RADFARLLVKYA
  296 -MDFKEKLKKYSETII-----KVGT-NVQKDQVVVIRANI-----E--AKELVRSLAEEA
  297 -MDFREKLKKYSETII-----KVGT-NVQKGQLVVIRANI-----E--AKELVRSLTEEA
  298 --EFKEKLKKYSETII-----KIGA-NVQKGQMVIIRANI-----E--AKDFVRSLTEEA
  299 -------FNEYAKVLI-----LKGV-NIQVDQKLVIRCPI-----E--AAFFAEMCAKIA
  300 --SFKENLKKYANLII-----REGL-KIKKDDLLVIRGPV-----E--TYEFINLIAETA
  301 --TFEKNLEKYAKLII-----NMGI-KVKQGDMVSISGEV-----V--NYEFLRHIAEEA
  302 ----TENLKKYAEVVM-----KKGL-NIVEGDSVVIEISI-----A--AREFAKMLVEAA
  303 -------FDKYADLVI-----KCAL-KIKAGDILVIRSPI-----E--ASLLTENLVKKA
  304 ----EKMFDKYADLVI-----KCAL-KIKAGDILVIRSPI-----E--ASSLTENLVKKA
  305 -------IEKYVELIL-----KVGL-KIKNGDKLVVRCPI-----E--ARDFAVECTRKA
  306 -MDLNTQLKNYAKLIA-----KVGL-NVQKDQPVLVRAST-----E--TRDFVAKIVEAC
  307 -MDLNTQLKKYAQLIA-----KVGL-NVQEGQPVLVRAST-----E--TREFVAKVVEAC
  308 ---LDKKLDNYAKLIA-----KVGL-NVQKDQPVLVRATT-----D--TRNFVVKVVKAC
  309 -----ERIENFARLAV-----EFGV-NVQKGEDVLIASPV-----E--SPELCRLITKAA
  310 ----NKRIENFAKLAV-----EFGV-NVQKGEDVLITSPV-----E--SPELCRLIAKAA
  311 -----KRIENFARLAV-----EFGV-NVREGEDVLISSPV-----E--SPELARLMTKAA
  312 ------KLENYAKLAV-----EFGV-NVQKNEDVLINSSL-----E--DPSLARLIAKYA
  313 ------KLENYAKLAV-----EFGV-NVQKNEDVLINSSL-----E--DPTLARLIAKYA
  314 -TVNKNKLENYAKLAV-----EFGV-NVQKNEDVLINSSL-----D--DPALARLIAKYS
  315 ---MIEQMRKYAELVV-----RVGV-NLQPGQPLVIGFGSRQVYPD--QVPFARLLAQAA
  316 -------LRKYAELAV-----KVGV-NLQPGQHLVIGYGIRQVLPE--HVEFARMLTEVG
  317 ---MDARLQKYAKLAV-----RKGV-NLQKGQTLIINTSV-----E--ALEMTRACVEEA
  318 ---MDARLQKYAKLAV-----RKGV-NLQKGQTLIINTSV-----E--ALEMTRACVEEA
  319 --------QKYAKLAV-----RKGV-NLQKGQTLIINTSV-----E--ALEMTRACVEEA
  320 ---MDARLQKYAKLAV-----RKGV-NLQKGQTLIINTSV-----E--ALEMTRACVEEA
  321 ---MDARLEKYAKLAI-----RKGV-NLQEGQTLIINTSV-----E--ARDMTRACVEEA
  322 -------IKKYANLAI-----RKGV-NLQKGQTLLIQADV-----D--AVEMTRACVEEA
  323 -------IKKYANLAI-----RKGV-NLQKGQTLLIQADV-----D--AVEMTRACVEEA
  324 --------QTYAKLVI-----VKGV-NVQKGQTLLINADI-----D--TVDMARACVEEA
  325 -------LRQYAELAV-----RLGV-NVQKGQLLVIKAQV-----D--SAPFVRMCVEEG
  326 MSASKAMYQKLAKLAV-----VRGV-NVQPNQPLVITASV-----R--DYEFVRMVAKEA
  327 ---------KLAKLAV-----NMGV-NVQKGQPLLVKANI-----Q--DVEFVRMISKEA
  328 ------LLKKYAKLAV-----CSGV-NVQKGQTVLVNVKA-----E--HYEFARLIVEEA
  329 ------LLEKYARLAV-----VTGA-NVQPGQVVVLRTST-----E--AVELTREVAKQA
  330 ------MLKKYAEVAL-----KIGL-NLQKGQILFIKAPI-----D--AREFVEQVVETA
  331 ------MLRKYATVAL-----QIGL-NLQKNQILFVKAPI-----D--AKEFVEEVVDVA
  332 ------LLEKYAELAV-----RVGV-NIQKGQRLLLRTSV-----D--AVEFSRLIAEKA
  333 -------LVNYAQAIL-----KVGV-NLQNGQKLIVNASV-----D--HKDFVRILVEQA
  334 ------ILRNYAQAIL-----KVGL-NLQNGQKLIVNASV-----D--HKDFVRLFVEEA
  335 MKTFEQKLDDYAKLIT-----KIGL-NIQKDQDFIITAPV-----S--AVEFIRLIVKEA
  336 -----QQMEIYATVLL-----KKGI-NLQENQILVINAPV-----E--SHDFVSVLAEKA
  337 ------------------------------------------------------------
  338 ----------YARVLL-----QKGI-CLQKDQILVINAPV-----E--ASRFATLLTEEA
  339 ----------YARVLL-----QKGL-NLQQGQTLVINAPV-----E--SHDFVALLTKEA
  340 -------LRAYAQVLL-----QKGI-NLQNKQLLVLSAPV-----E--AHEFVAIIAAEA
  341 ----------YAQVLL-----QKGI-NLQNKQLLVLSAPV-----E--AHEFVAVITAEA
  342 ----QETLKKYAHTLL-----KYGV-NLQEDQTLVISVDV-----E--NKDFAVIVTEEA
  343 ----QETLKKYAHTLL-----KYGV-NLQQDQTLVISVDV-----E--NKDFAVIVTEEA
  344 -----DTLRKYTRTLL-----QYGV-NLQQDQTLVISVDV-----E--NKDFAVIVTEEA
  345 ----QDTLRKYARTLL-----QYGV-NLQQDQTLVISVDV-----E--NKDFAVIVTEEA
  346 ----QDTLRKYARTLL-----QYGV-NLQQDQTLVISVDV-----E--NKDFAVIVTEEA
  347 ----QDTLRKYARTLL-----QYGV-NLQQDQTLVISVDV-----E--NKDFAVIVTEEA
  348 ----QELLRKYARTLL-----QSGV-NLQEKQTLIVSVDV-----D--NKDFAVIVTEEA
  349 -----EDLQQYARLLL-----QEGV-NLQQDQLLVINGDV-----E--NKDFVYIVVEEA
  350 ------NIEKYVELIL-----KVGL-NIQKGDNLLVLVSE-----H--TLGMVREVTRQA
  351 -MDFKRNIEKYVELIL-----KVGL-NIQKGDGIFVLVNE-----H--SIGMVREVTKQA
  352 ----ERNLEKYAELAV-----KVGI-NLKEKEGLLIMGNV-----D--TLPLARLIMKKA
  353 --------QKYADFIV-----RVGV-NPQPGQTLIINCPL-----E--GAPLARLCVRSA
  354 -------VKQYAEFAV-----KIGV-NPQPGQTLIIRAPI-----E--GAFFARACAEAA
  355 --------QLYADFVV-----KVGV-NVRPRQNFIVRCPV-----T--MPEFAHACVRAG
  356 MDAFKRNLEKLAELAI-----RVGL-NLEKGQEVIATAPI-----E--AVDFVRLLAEKA
  357 MDAFKRNLEKLAELAI-----RVGL-NLEKGQEVIATAPI-----E--AVDFVRLLAEKA
  358 -------------------------------------------------MDFVRLLSQKA
  359 MSAFAEKLEKLAELAI-----RVGL-NLEKGQEIIATAPL-----E--ALDFVRLLAEKA
  360 MDAFTENLNKLAELAI-----RVGL-NLEEGQEIVATAPI-----E--AVDFVRLLAEKA
  361 VSAFQENLEKLADLAI-----RVGL-NLERGQEVIATAPL-----E--AVDFVRLLAEKA
  362 -MTHEEKLDRLAEVAV-----RIGV-NVQTGQELIVNAPI-----E--ARDLVDRIATHA
  363 -MTHEEKLDRLAEVAV-----RIGV-NVQTGQELIVNAPI-----E--ARDLVDRIATHA
  364 -------LDKLADVTV-----QVGL-NLQRGQELVITAPI-----E--ALPLTRKITERA
  365 -------LDSLAKVAV-----HVGL-NLQEGQELLITAPI-----E--AVPLVRKITEYA
  366 ------RLDRLAEVAV-----RVGL-GLTPGQELVMTAPV-----E--ALPLARRITEHA
  367 ------RLDRLGEVAV-----HVGL-GLRPGQELVMTASI-----D--ALPLVRRITEHA
  368 ------RLDRLAEVAV-----RVGL-GLQPGQELVMTAPL-----E--ALGLARRITAQA
  369 ------RLDRLAEVAV-----RVGL-GLRPGQELVMTAPL-----E--ALGLARRITAEA
  370 ------RLDRLAEVAV-----RVGL-GLKAGQELVMTAPL-----E--AVPLARAITEQA
  371 ---FTERLDRLAEVAV-----RVGL-GLKAGQELVMTAPL-----E--AVPLARAITEQA
  372 ------------------------------------------------------------
  373 ------RLDRLAEVAV-----RVGL-GLRPGQELVMTAPL-----E--AVPLARAITEHA
  374 TPIDPVKLDRLAEVAV-----KVGL-QLAPGQDLLITAPA-----V--ALPLVRRIAEHA
  375 TPIDPVKLDRLAEVAV-----KVGL-RLAPGQDLLITAPA-----V--ALPLVRRIAEHA
  376 TPIDPVKLDRLAEVAV-----KVGL-QLAPGQDLLITAPA-----A--ALPLVRRIAEHA
  377 --IDPVKLDRLAQVAV-----KVGL-NLQEGQDLFLTAPI-----A--ALPLVRRIAEHA
  378 -------LDRLAEVAV-----KVGL-QLQPGQDLLLTAPS-----V--ALPLVRKVAEHA
  379 TAIDPVKLDRLAEVAV-----RVGL-QLQPGQDLLLTAPS-----V--ALPLVRKVAEHA
  380 -------LDRLAEVAV-----KVGL-QLQPGQDLLLTAPS-----V--ALPLVRKVAEHA
  381 ------------------------------------------------------------
  382 -------LDRLAEVAV-----KVGL-QLRPGQDLLLTAPS-----V--ALPLVRKVAEHA
  383 -------LDRLAEVAV-----KVGL-RLQPGQDLLLTAPS-----V--ALPLVRRIAEHA
  384 TPIDPAKLDRLAEVAV-----KVGL-GLRPGQDLLLTAPA-----I--ALPLVRRIAVHA
  385 -------LDRLAEVAV-----KVGL-GLRPGQDLLLTAPA-----I--ALPLVRRIAVHA
  386 -------LDRLAEVAV-----KVGL-GLRPGQDLLLTAPA-----I--ALPLVRRIAVHA
  387 -------LDRLAEVAV-----KVGL-GLRPGQDLLLTAPA-----I--ALPLVRRIAVHA
  388 -----VKLDRLAEVAI-----KVGL-QLQPGQDLVLTSSI-----A--ALPLTRRIVEHA
  389 -----VKLDRLAEVAI-----KVGL-QLQPGQDLVLTSSI-----A--ALPLTRRIVEHA
  390 -------LDRLAEVAI-----KVGL-QLQPGQDLVLTSSI-----A--ALPLTRRIVEHA
  391 -----MKLDRLAEVAI-----KVGL-QLQPGQDLVLTSSI-----A--ALPLTRRIVEHA
  392 -------LDRLAEVAI-----KVGL-QLQPGQDLVLTSSI-----A--ALPLTRRIVEHA
  393 -PIDPVKLDRLAELAI-----KVGL-RLQAGQDLLVTAPT-----A--ALPLVRLVADHA
  394 -------LEKLAEVAV-----KVGL-RLQRGQDLVITAPV-----V--ALPLVRLITKHA
  395 -------LEKLAEVAV-----KVGL-QLQKGQDLVITAPV-----V--ALPLVRLITKHA
  396 NTIDPVKLEKLAEVAV-----KVGL-QLRKGQDLVVTAPV-----V--ALPLVRLITKHA
  397 --VDTAKLEKLAEVAV-----KVGL-QLQGGQDLLVTAPV-----A--AMPLVRLITREA
  398 NPVDPVKLEKLAEVAI-----KIGL-QLQKGQDLVMTAPI-----A--ALPLVRLITKHA
  399 NPIDPVKLEKLAEVAI-----KVGL-QLQKGQDLVMTAPI-----A--ALPLVRLITKHA
  400 NPVDAAKLEKLAEVAV-----KVGL-QLQRGQDLVMTAPI-----A--ALPLVRLITRHA
  401 -------LEKLAEVAV-----KVGL-QLQRGQDLVMTAPI-----A--ALPLVRLITKQA
  402 --IDPVKLDKLAEVAV-----KVGL-RLVPGQDLVITAPL-----N--ALPLVRNITRHA
  403 -------LEKLGEVAV-----KVGL-QLQAGQDLVITAPI-----A--ALPLVRHITKHA
  404 -------LEKLAEVAI-----KVGL-QLQKDQDLVITAPL-----A--ALPLVRLLTKHA
  405 SPIDPVKLEKLAEVAI-----KVGL-QLQKDQDLVITAPL-----A--ALPLVRLLTKHA
  406 SPIDPVKLEKLAEVAV-----KVGL-QLQKDQDLVITAPL-----A--ALPLVRFLTKHA
  407 SPIDPVKLEKLAEVAV-----KVGL-QLQKDQDLVITAPL-----A--ALPLVRFLTKHA
  408 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIAKHA
  409 --IDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIAKHA
  410 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  411 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  412 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  413 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  414 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  415 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  416 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  417 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  418 SAVDPVKLERLAEVAV-----RVGL-QLREGQDLVITVPV-----V--ALPLVRLIARHA
  419 -------LERLAEVAV-----RVGL-QLREGQDLVITVPV-----V--ALPLVRLIARHA
  420 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  421 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  422 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  423 ----------------------VGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  424 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  425 ------------------------M-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  426 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  427 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  428 -------LERLAEVAV-----RVGL-QLREGQDLVITAPV-----V--ALPLVRLIARHA
  429 -------VDRLAEVAV-----KVGL-RLEAGQDLVLTAPT-----T--ALPLVRRIVAHA
  430 -PVNEEKLDKLAQVAI-----HTGL-GLEAGQDLLITAPL-----S--ALPLVRKITEHA
  431 -----EMLDRLAEVTI-----KVGL-NLQEGQDLVLTAPV-----T--ALPLVRQIALHA
  432 -----EMLDRLAEVTI-----KVGL-NLQEGQDLVLTAPV-----T--ALPLVRQIALHA
  433 -----EMLDRLAEVAV-----KVGL-NLQEGQDLVLTAPV-----T--ALPLVRQIAYHA
  434 --ISPEMLDRLAEVAI-----KVGL-NLQEGQDLVLTAPV-----K--ALPLVRRITYYA
  435 --IFPEMLDHLAEVAV-----KVGL-NLQKGQDLVLTAPV-----E--ALPLVRRIAYHA
  436 ETISPEMLNRLAEITV-----KVGL-NLQEGQDLVLTAPV-----S--ALPFVRRIAYHA
  437 EAISPEMLNRLAEVTV-----KVGL-NLQERQNLVLTAPV-----S--ALPFVRRIAYHA
  438 EIISPEMLNRLAEITV-----KVGL-NLQEGQDLVLTAPV-----S--ALPFVRRIAYHA
  439 ETISSEKLNRLAEITV-----KVGL-NLQKGQDLVLTAPI-----S--ALPFVRRIAYHA
  440 ------QVQRLADVAV-----RTGL-NLQPGQELVLTAPI-----D--AAPLVRAVAAAA
  441 SPIDPTQVQRLADVAV-----RTGL-NLQPGQELVLTAPI-----D--AAPLVRAVAAAA
  442 -------LDRLADVAV-----HTGL-NIQPGQQLVITAPA-----D--ALPLVRRITTAA
  443 ------QLDKLAEVAV-----RVGL-NLQPGQDLVLTAPV-----A--ALPLVRRVVAEA
  444 -------LDKLAQVAV-----RVGL-NLAEGQELVMTAGV-----E--SLPLARKITEAA
  445 -------LDRLAEIAV-----HVGLGGLKPGQELLMTASV-----E--ALPLVRRITEHA
  446 --IDPAKLDRLAEVAV-----RTGV-NLQPGQDLVITAPM-----A--ALDLVRRITVHA
  447 --IDPVKLDRLAEVAV-----RTGV-NLQKGQDLVITAPL-----S--AIELVRAITVHA
  448 -------LDRLAEVAV-----RVGV-NIAHGQQLLITAPL-----D--AVPLVRRITEHA
  449 -------LDRLAEVAV-----RVGV-NVAHGQQLLITAPL-----D--AVPLVRRITEHA
  450 ---HEHLLDRLAEVAV-----RVGV-NIAHGQQLLITAPL-----D--AVPLVRRITEHA
  451 -------LDRLAEVAV-----RVGV-NIAHGQQLLITAPL-----D--AVPLVRRITEHA
  452 -----ELLDRLGEVAV-----RVGL-NIAHGQQLLITAPL-----D--AVPLVRRITEHA
  453 --SHDGLLDRLAEVAV-----RTGL-NLAPGQQLLITASL-----D--AVPLVRRITEHA
  454 TFSHEQLLDRLGEVAV-----RVGL-NIAPGQQLLITAPL-----A--AVPLVRRVTEHA
  455 -------LDRLGEVAV-----RTGL-NLAHGQQLLITAPL-----E--AAPLVRRVTEHA
  456 ---FATMLDRLGEVAA-----RTGL-NVAHGQQVIITAPL-----H--AVPLVRRITEHA
  457 ---FATMLDRLGEVAA-----RTGL-NVAHGQQVIITAPL-----H--AVPLVRRITEHA
  458 ---FATMLDKLGEVAA-----RTGL-NVAHGQQVIITAPL-----H--AVPLVRRITEHA
  459 -------LDRLGEVAV-----RTGL-NVAPGQQVIITAPL-----E--AVPLVRRVTEHA
  460 -------LDKLAELSI-----KTGV-ALQPGQDLLITAPL-----E--AAPLVRRLANHA
  461 ------KLDRLADVAV-----RVGL-GLKEGQELVLTASV-----D--TLPLVRRITAHA
  462 ------KLDQLAEVAI-----RIGL-GLAPGQELLMTAPL-----D--ALPLARRITEQA
  463 -------LDRFARLAV-----HVGL-NLQPGQELLITAST-----E--MIPFVRLITEHA
  464 -------LDRLALVAV-----RVGL-NLQPGQEIVVSASL-----E--HIPFVRRITEHA
  465 -------LDRLAEVAI-----RIGL-NLREGQELVLTAPT-----D--ALPLARRLTEHA
  466 --IDVTLLEKLAKVAL-----QVGV-HIREGQHLIVMAPV-----D--ALPLTRLITQHA
  467 --VDEFLLEKLAKVAL-----QVGV-NIQEGQHLIVMAPV-----S--ALPLARLITKHA
  468 -------LEKLAKVAL-----QVGV-NIQEGQHLIVMAPV-----S--ALPLARLITKHA
  469 ------QLRRLAEVTV-----RVGV-GLQPGQKLFINANL-----E--ARPLTRRVVEEA
  470 -LTFEEKLRNYARLAV-----RVGL-GIQEGQRVLVQAPV-----D--TAPLARALVREA
  471 ---FEDKLRNYARLAV-----RVGL-GIREGQRVLVQAPV-----D--TAPLARAVVREA
  472 NLSFEEKLRNYARLAV-----RIGL-GVREGQRVLVEAPV-----E--TAPLARLLVREA
  473 DLSFEQKLQNYARLAV-----RVGL-GVKPGQRVLVQSPV-----D--AAPLARLIVREA
  474 -LTFEQKLENYARLAV-----EVGA-GLRAGQRLLIQSPV-----D--AAPFARAIVRAA
  475 ---FDEKLRKYAQLAV-----RTGV-GLRPGQRLLIESPI-----E--TAPLARALAEAA
  476 ------KLSAYAELIT-----HVGL-NLRAGQQLLATAPV-----E--ASPLLAKVAEAA
  477 ---FQTRLARYAELLV-----RTGV-NLPRGGKLFVAAPL-----E--AAPLARLIARAA
  478 -SDFETKLARYAELLV-----HTGV-NLPTGGKLLVNAPL-----E--AAPLVQHVARAA
  479 PSSFDDKLARYAELLV-----RIGV-NLPEGGKVRIHAPI-----E--AAPLVRLVARAA
  480 PSSFDERLARYAELLV-----KVGV-NLPAGGKLLVNAPL-----S--AAPLVRLVARAA
  481 --TFEEKLREYARVLV-----GTGV-GLKAGGKLLINAPI-----D--AVPLVREMVAEA
  482 --SFEQKLENYARLLV-----RVGV-NLQPGGKLHLSAPV-----G--AVELARLITREA
  483 ----EERLQRYADLAL-----RVGL-NLQEGQPLVLSGSA-----E--SRPLLRALARGA
  484 ---------RFAALCV-----TAGL-DLREGQELIVSAPI-----E--AQSFVGHVAGAA
  485 MKTFETKLEQYAELVI-----KVGI-NIQQGQTLVISASM-----A--AADFVRRVCRHA
  486 ----QERLDRYADLLI-----RTGV-NLQPRQGLLIRAEL-----G--HAPLVRAAIAAA
  487 ---------KYADLIV-----RSGL-NVQKDQIVVVRANV-----E--MNEFVRLIVKSC
  488 -----------------------GA-NLQPGQVLAVNGQV----GG--HEPLVRAIAAEA
  489 ---DPATLARYADLVV-----GFAA-NVQDGQLVEIASET-----G--KEALTRALAASA
  490 ---MKKDLIKYAELII-----LKGI-NLQKNQCVLITGSI-----E--NYEFLRILAQKA
  491 ---MKTDLIKYAELII-----LKGI-NLQKNQCVLITGSI-----E--NYEFLKILAQKA
  492 ---MKKDLIKYAELII-----LKGI-NLQKNQCVLITGSI-----E--NYEFLRILAQKA
  493 ------------------------------------------------------------
  494 ---MKKDLIKYAELII-----LKGI-NLQKNQCVLITGSI-----E--NYEFLRILAQKA
  495 ---MEKDLIKYAELII-----LKGI-NLQKNQCVLIQGSI-----E--NYNFLQILAKKA
  496 ---MEKDLIKYAELII-----LKGI-NLQKNQCVLIQGSI-----E--NYNFLKILAKKA
  497 ---MEKDLIKYAELII-----LKGI-NLQKNQCVLIQGSI-----E--NYNFLKILAKKA
  498 ---MEKDLIKYAELII-----LKGI-NLQKNQCVLIQGSI-----D--NYNFLKILAKKA
  499 ---MEKDLIKYAELII-----LKGI-NLQKNQCVLIQGSI-----D--NYNFLKILSKKA
  500 ---MEKDLIKYAELII-----LKGI-NLQKNQCVLIQGSI-----D--NYNFLKILAKKA
  501 ---MEKDLIKYAELVI-----LKGI-NLQKNQCVLIQGSI-----E--NYNFLRILAKKA
  502 ----EDELRAYARVIV-----QVGV-NLRPGQCFLIGTGP-----G--NYEFARLTADEA
  503 --MDQKLIESYADLVV-----RRGI-NLQKNKSVAILSGP-----G--TYYFARALAKAA
  504 --MDQKLISTYADLII-----EKGI-NLQQGKNVFILTGP-----G--TYYFARELSKSA
  505 -------IDRYARLVL-----RKGI-NLKKGQNLFIKTGP-----G--TYYFARSLAKCA
  506 MKSMKKQLEKLIDIWL-----QVGI-NIQGGQPLYITLPD-----E--YTYLKEIFDVKA
  507 -------LENLVDVWL-----RVGV-NIQPNQLLYVTIPS-----E--YISLKDIFDKKT
  508 ------RISNLARLIV-----NYCV-YLRKGEEVVINASV-----E--SIPLVREIVRYT
  509 -------ISNLARLIV-----NYCV-YLRKGEEVVINATV-----E--SIPLVREIVRYT
  510 ------RISNLARLIV-----NYCV-HLGKGEEVVINATT-----E--SIPLVREIVRHV
  511 ------RTSNLARLIV-----EYCI-EAGKGDEVVINAGV-----E--AVPLVREIVKYL
  512 ------RVSNLARLLV-----EYCI-EAGKGDEVVVNAGV-----E--AIPLVREVVKYL
  513 ------RISKQAEIIV-----DYSL-NLKPGEEVVINASV-----E--AVPLVRELVRKI
  514 ------RISKLAKLIA-----EYCV-SIRPGDEVVISAGL-----E--ALPLVRELYREV
  515 ------------------------------------------------------------
  516 -----------ARLIV-----EYCI-GVEKLTDVVIYSSI-----E--ALPLVRELWREI
  517 VYRFVSKTGEAARLIV-----DYCI-SASRGDDVAVSFGL-----P--AIDFARAVALEV
  518 ------------------------------------------------------------
  519 -------LNKYAKLLV-----DYSL-ELKKGDQVLIQAED-----V--SQALVKEVYQEV
  520 --MVNPMIEKYARVIV-----NYSL-GINKGDSVLIQGNM-----I--TEPMIKAIYKEV
  521 ---------KMADLLC-----EYSL-NLKRGDTVEIRGEV-----A--SEPLIKACYIKL
  522 ---------KLAKLLC-----DYSL-KVKKGDVVEIRGES-----C--AEPLIRACYVYL
  523 ---------KMAQLIC-----EYSL-DLKEGDIFLIRSET-----V--AEPLVKEFVRKT
  524 ---------KLAKLIC-----EYSL-ALRKGDILLIRAET-----V--SEPLIKEIYAKT
  525 --MVDPRTEKLADLLV-----NYSI-EVKPGDTVAVNYFS-----G--ALPLAVEVYKKI
  526 --MVDPRTEKLADLLV-----NYSI-EVKPGDKVAVNYFS-----G--ALPLAAEVYKKI
  527 --MIDPRVEKLADLLV-----NYSI-EVKPGDTVAVNYFS-----G--ALPLAVEVYKKI
  528 --MIDPRVEKLADLLV-----NYSI-EVKPGDTVAVNYFS-----G--ALPLAVEVYKKI
  529 --MIDPRVEKLADLLV-----NYSI-EVKPGDTVAVNYFS-----G--ALPLAVEVYKKI
  530 --MTDPRINKLAELLV-----RYST-RIQPGDKAVINTPQ-----A--ALPLARAIYREV
  531 ------NVTRMAQVLV-----DYST-AIQPGDTVLIEATT-----L--AEELVREVYRRV
  532 ------------------------------------------------------------
  533 ------------------------------------------------------------
  534 --MADPRVLKMAHTLV-----NYSM-KIKEGELVVLQSEP-----A--AAPLVQAMYREI
  535 --MTDPRVRKLAQVLV-----RYSL-GLEAGDHFLIQTTD-----L--ATPLVQAIYREA
  536 --MTDPRVRKLAQVLV-----RYSL-GLEAGDHFLIQTSD-----L--ATPLVQAIYREA
  537 --MADPYVEKMAQVLV-----RYSL-ALKPGDLFRIIAPP-----A--AAPLVRALYKEA
  538 --MADPRVEKMAQVLV-----HYSL-AIKPGDLFRIIAPP-----A--AAPLVRALYREA
  539 --MTDPRIAKWARVLV-----DYSL-AVQPEQLVVIGGTP-----L--AAPLIREVYRLV
  540 ------------------------------------------------------------
  541 ------RIERLARVLT-----EYSL-ELQPEERVVMIGSP-----L--AAPLLLAAYQHA
  542 --MTDPRHQKLAQVLI-----NYSL-GIQPGDKLIITAPA-----A--AAPLVKEAYREA
  543 ------VEITFAELLS-----DYCL-EARPSQTVLIEAQT-----P--ALPLIQALVPAL
  544 ------MERRFAELLV-----DYCL-EAQPGQNVLLEAGT-----A--ALPLVEALYSAL
  545 ------MEARFAELLA-----AYCL-EAQSGETVLVEAET-----P--ALPLLSHLKRAL
  546 ------------------------------------------------------------
  547 ------MEAAFAQLLV-----EYCL-EAQEGETILVEAEA-----P--ALPLLPHLKRAF
  548 ------MESRFAWLLA-----RYCL-DLQPGQTVLIEAEP-----A--ALPLLEALHEVV
  549 -----------AELLA-----GYCL-DVQPGQQVLVRSTT-----L--AAPLLRALQRAI
  550 ------MERELARLIL-----DYSR-PVEAGETLLIQAEM-----E--AWPLLRELHREA
  551 ASPLSYDPARHAALLA-----DYCL-GAQPNERLLVAGGT-----A--ALPLVREVTRSF
  552 ---LPYDPVRHAALLA-----DYCL-MAAPGERLLVAGGQ-----A--ATPLIREVTRAL
  553 ASLLAYDPERHAELLA-----HYCL-SAQPGERLLVGAST-----A--AAPLVAATSRAL
  554 -SLLSYDPAKHAELLV-----DYCL-YAQPGERLQLASST-----L--ALPLMQELYRTV
  555 -----YNPEKHADLLV-----DYCV-YVKPGERILVHGST-----L--ALPLLEALHRAL
  556 -----------ADLLV-----AYCM-DVQPGENVLLNLES-----P--AMALARPLVRAV
  557 --MRDERLRKLARLLV-----EYSI-GAREGEQVLLSGGA-----A--AGPLIREVYTSL
  558 -----------ADLLT-----GYCL-AVQPGEAVAIVSEL-----E--ARPLVEACFRAV
  559 --MTDDLTGRWADLLV-----DYCL-RVAPGEKILIASEL-----E--ARPLVEACYRAV
  560 --MFDQRWQQLAKIIV-----HHSL-ELQPNDLLRIQAEA-----I--AKPLLYALYREA
  561 --MRDRRIDRWADVLV-----NYAL-QAKSGQHAVIVGEY-----E--ALPLIEASYEKF
  562 ---MDPRIREHAEVIV-----DHSI-DLSEGDNLVIDAHP-----Q--ASDLVTALHEFA
  563 ---MDPRIREHAEVIV-----DHSI-DLSEGDNLVIDAHP-----Q--AADLVTALHEFA
  564 ---MDPRVREHAEIVA-----DHSV-ELQAGDDVVIDAHP-----D--AADLVTALHEVI
  565 ---MDPRIREHAEIIA-----NHSV-DLEEGDNVVIDAHP-----V--AEDLVVALHEVI
  566 ---MDPRIREHAEVIA-----NHSV-DLQEGDNVVVDAHP-----V--AEDLVVALHEVI
  567 ---MDPRIRNHAEIIA-----NHSV-DLQEGDNVVIDAHP-----V--AEDLVVALHEII
  568 ---MDPRIREHAETIV-----DHST-DIAEGDDVIVSAPP-----V--ASDLVVALFEVL
  569 ---MDARIREHATIIV-----DHST-EVQPGDNVVISAPS-----E--AEDLAVALHEVV
  570 ------------------------------------------------------------
  571 ---MDPRIREHAQLVA-----D-AL-DLSEGDNLLIKSEP-----A--AEDLVVALYEIA
  572 -----------AETIV-----DHSI-DVEAGDTVVVRAPT-----V--ADDLAVALSELL
  573 ---MDPRIREHAQIIA-----DHSA-DISDGDNVVINAPA-----A--AEELVVALHEEC
  574 ---MDPRIRDHAQTVI-----DHST-DIDSGDRVVIGAPA-----A--ASDLVIALYEEC
  575 ---MDPRIREHARTIV-----DHST-SVEAGDNVVVSAPS-----V--AEDLVTAIHELL
  576 ---MDARVREHAEIIA-----DHST-DIQSGDDVVIQMPK-----E--AEDLAVALHEIC
  577 ---MDPRIRDHAETIV-----EHSA-GVEASDDVIVYLPS-----N--AEDLGVALHELL
  578 ---MDSRIRQHAAVIV-----DRCI-DLQPDENVVVSLPP-----V--AEDLRVALYEKI
  579 -------IRRHAEVIV-----DRAI-DLQPDENVVVSMPP-----V--AEDLAVALYEQI
  580 ---MDERIQEHARTLL-----NWST-DVQRDDDVVIAAGP-----E--AHDLVVALHREL
  581 -----DRIHEHAETLV-----DWSG-RIESGDDVVLSVDE-----G--AHDLAVAVAEVL
  582 ---MDDRIHEHAAVLV-----DWSA-RIESGDDVVLSVDE-----G--AHDLAVAVAEKL
  583 ---MDDRVREHADVLV-----DWSA-RIEAGDDVIVQVDE-----G--AHDLGVAVAAAL
  584 GGDMDDRIREHARILV-----DWSA-RIDAGDDVVVAVED-----G--AHDLAVAVAEQL
  585 ---MDDRIREHARILV-----DWSA-RIDAGDDVVVAVED-----G--AHDLAVAVAEQL
  586 ---MDPRVEEHAEVLV-----DWSA-RIEAGDNVVLSVGP-----D--AHELAVAVAERV
  587 -----------AEVLV-----GWSA-RVEEGDNVVLNVGP-----D--SHELAVAVAEKV
  588 ---MDERVREHADVLV-----DWSA-RVEAGDDVVLSVGP-----D--AHELAVAVAEKL
  589 ---MDERVREHAEVLV-----DWSA-RVEAGDDVVVSVGP-----D--AHELAVAVAEKL
  590 ---MDERVREHADVLV-----DWSA-RVEAGDDVVLSVGP-----D--AHELAVAVAEKL
  591 ---MDERIREHAEVLV-----DWSA-RVEAGDNVVLSVGP-----D--AHELAVAVAEKL
  592 ---------------------------VEDGDDVVLSVGP-----D--AHELAVAVAEKL
  593 -----------AEVLV-----DWSA-RIESGDDVVVSVAE-----G--AHELAVAVAEKL
  594 -----ERIHEHAAVLV-----DWSA-RIETGDDVVVSVGE-----E--AHDLAVAVADAL
  595 -----DRIHEHAEVLV-----DWSA-RIEEGDDVVVITDE-----G--AHDLAVAVGEAV
  596 ---MDDRIHQHASVLV-----DWSA-RITAGDNVVVNVAE-----G--AHNLAVAVADVL
  597 ---MDERWRKLGDLLV-----NYSL-EIKRDEKLLITMEE-----I-NSYPATCGVYEAA
  598 ---MDERWRKLGEILV-----RYST-SVKPGEKVMIYMGE-----V-ESFPLVEAIYEAT
  599 ------------------------------------------------------------
  600 --MLDPRLTKLANVLV-----NYST-NVQPGDNVLIDAME-----V--DAALIKELVKAV
  601 -------VNELARLLV-----THSM-KVKPGENVLIDLFG-----E--KEELARALIAEV
  602 --MRDARLQKLAANLA-----GYSI-DVQPGDNVLIDLIG-----L--ELELGKCLIEEV
  603 --MRDPRIQKLAQNLV-----NYSV-DMQPGENVLIEMIG-----S--ERDLLNAIIEEV
  604 --MRDPRLEQLARNLV-----EYSL-DVQKGEKVLIDMIG-----S--ERELVKCLVEQV
  605 --MRDPRLEIFAKNII-----RYST-ELQPGENILIELIG-----L-KDNELAKCFIEEV
  606 --MADPRINELASRLV-----RYSL-HLQKGEKVLIENTG-----L--QPELVRALVRES
  607 --V-DPRIITLARNLV-----NYSC-DLQPGEKILIEAIG-----L--ELPFVKELIKEV
  608 --V-DPRITQLAKNLV-----IYSC-EIKPGEKILIENIG-----L--EPPLVKELVKQV
  609 --I-DPRLSKLAGNLV-----HYSC-QVQEGEKVFIENIG-----L--ELPLVKELVKTV
  610 ----DPRIEKLAQNLI-----NYSC-ELKAGEKILIENIG-----N--EIPLSRALIREA
  611 --M-DPRIATLAHNLI-----TYST-DLKPGEKLLIEVFD-----N--ALPLAKALVDEA
  612 ----DPRYEKLARILI-----HYSV-ELKEGENILIEAGP-----G--EAPLVKELVREI
  613 --MNDPRIDNLASILI-----DYSV-ELKTGENILIEVSG-----L--EIPLAKAIARKV
  614 --MKDPRIEKLADSLI-----NYSI-ALQPGEKILIEVTG-----P--DIPLAQALVGYA
  615 --MKDPRMEKLAQTII-----NYAI-ELKPEEKVLIEVNG-----L--EIPLAQALVKYA
  616 --MRDSRVEKLAYNLI-----NYSV-DLQPGEKVLIEAVG-----L--EYPLVQALIRET
  617 --MKDPRIEKLADVLV-----NYSV-TVKPGENVLIYSIG-----N--VTDLTKAVIAKV
  618 --MRDSRLDQLAYNLV-----NYSV-RVQPGENILINAKG-----D--TPDLVQALVREI
  619 --MRDPRITELADNLI-----NYSI-RLQPGEKVLIENFG-----L--QRDLVTALVEKA
  620 --MRDPRITTLAKNLI-----QYSV-NLQKGEKVLIENFG-----L--QKELVTALVKEA
  621 --MKDPRIQTLAKNLI-----NYSV-RLQKGEKVLIENFG-----L--QRELVTALVAEA
  622 --MKDPRIEKLAKNLI-----HYSL-RLQKGEKVLIENFG-----L--QRELVIALVREA
  623 --MKDPRIATLAKNLI-----NYSV-SLQKGEKVLIENFG-----L--QRELVTALVDEA
  624 --MKDPRIEKLARNLI-----RYSV-QLQKGEKVLIENFG-----L--QRELVTALVKEA
  625 --MKDPRIEKLAYNLI-----NYSI-RLQKGEKVLIENFG-----L--QKELVTALVKEA
  626 --MKDPRIEKLAYNLI-----NYSI-RLQKGEKVLIENFG-----L--QKELVTALVKEA
  627 --MKDPRIEKLAYNLI-----NYSI-RLQKGEKVLIENFG-----L--QKELVTALVKEA
  628 --MKDPRIEKLAYNLI-----NYSI-RLQKGEKVLIENFG-----L--QKELVTALVKEA
  629 --MKDPRIEKLAYNLI-----NYSI-RLQKGEKVLIENFG-----L--QRELVTALVKEA
  630 --MRDTRIEKLAHNLI-----NYSV-KLGAGEKVLIENFG-----V--QKELVMALVEEA
  631 --MRDTRIETLAHNLI-----NYSV-KLRAGEKVLIENFG-----V--QKELVMALVEEA
  632 --MKDARIEKLAHNLI-----NYSV-KLGAGEKVLIENFG-----V--QKELVMALVEEA
  633 --MRDVRIEKLAHNLI-----NYSV-KLGAGEKVLIENFG-----V--QKELVMALVEEA
  634 --MRDARIEKLAHNLI-----NYSV-KLGAGEKVLIENFG-----V--QKELVMALVEEA
  635 --MRDPRLTQLATNLI-----NYSV-ALAPGEKVLIENFG-----I--ERELVEALVDAA
  636 --MRDPRITQLADGLI-----NYSV-KLQPGEKVLIENFG-----V--EESLVEALVEKA
  637 --MRDPRINQLAKNLI-----EYST-EMKQGENILIENFG-----V--QEELVKALIEEA
  638 --MRDPRIQVLAKNLI-----NYSV-NLQKGEKILIENFG-----I--QKELVNALVEEA
  639 ----DERIKKLAKVLV-----NHSC-RVQKGEKVYIHYVG-----Y-ETKALARQLIKEV
  640 ----DERLKLLARNLI-----EYSV-ELKEGENILIELIG-----Q--EIELAKELVKLS
  641 ----DERLKLLAKNLI-----EYSV-ELKEGENILIELIG-----Q--EIELAKELVKLS
  642 ----DERLKLLAKNLI-----EYSV-ELKEGENILIELIG-----Q--EIELANQLVKLS
  643 ----DERLKLLAKNLI-----EYSV-ELKEGENILIELIG-----Q--EIELANQLVKLS
  644 ----DERLKLLAKNLI-----EYSV-ELKEGENILIELIG-----Q--EIELAKELVKLS
  645 ----DERLKLLAKNLI-----EYSV-ELKEGENILIELIG-----Q--EIELAKELVKLS
  646 --V-DERVKVLAKNLI-----EYSV-ELKSGEKILIELIG-----E--EIDLAKELIDLS
  647 --M-DPRFIKLAQNLI-----HYST-ALKPGEKILIENIG-----P--ELPLTKALIREA
  648 ----DSRIEKLAKNIV-----TYSC-KLKKGEKILIKSYG-----EGEERNLVNAIIKEV
  649 ----DTRIEKLAKTIV-----NYSC-KLKKGEKVLIKSYG-----VGDERNLVTAIINEV
  650 --MKDPRMDALARNLI-----RHSV-RAQKGEKVLIQANN-----C--VPELVRALVRET
  651 ----DKRIEQLAHNLV-----TFST-NVQKGEKVLINAGG-----IEDTRDLVKALVREV
  652 --MKDPRITQLAENLI-----NNAI-ALKAGENILIETTD-----T--PDELSTELIKAV
  653 -------YTKLAEGLT-----GFST-NLQKGERVLIDAFD-----I--PEAMTIALVRAA
  654 ----DPRFTQLAAGLT-----GFST-SLKKGERVLIDAFD-----V--PDAMVVALIRAA
  655 --I-DPRLSQLAKNLT-----RYST-NLKEGERVLIDAFD-----V--PDEIIVELIRSA
  656 ----DPRFDKLAHGLV-----NFST-KLVKGDKVLIDAFD-----I--PPEMSIALVRAA
  657 --MTDPRYAKLAKLLV-----EYST-ELKKGDKALLDMID-----V--PDEFTVELMRAV
  658 --M-DSRIVKLAEIIV-----QHSC-RLEPGERVLIEAFD-----L-PSPDLVTELVRQA
  659 ----DERLGKIADNLI-----SYSL-DVQAKQHIMIMVVD-----E--GEALAMELVKRL
  660 --MLDTRIVKLATNLL-----SHSV-RLKEKESLLIEVRG-----E--GHALAKELVKQA
  661 --MKDQRHDELAKLLV-----EYSI-RLQAGERCLIQSVD-----V--PVEMVEALIRAV
  662 --MNVTREKKLAALLV-----SHSV-RLQKGESCLIEAID-----L--PVTMTEALIEAV
  663 --MRDPRFQALAAQLA-----GYST-ALRPGDRVLLELTD-----I--PEEMGIALIREA
  664 --MADPRWQILADLLL-----NHSV-KLAKGETLLVECFD-----L-DDLTLPGLLVRGA
  665 ----DSRIHTLAKTVV-----QYSL-NVQKGDKVLIEALD-----V-HNYDYIAPFMDAV
  666 --MKDPRVQRFAEILV-----DYST-RVGKGDVVLINAAG-----L-EATPLVKEIYQLC
  667 --MRDPRVAEMAKVLV-----DYST-RIKKGDRVLISAAG-----F-EAAPLVKELYALC
  668 --MKDPRVRQLAEVLV-----NYST-GVKKGDVVLISASG-----M-ESVPLVKELYALC
  669 --MKDTRVRQLAEVLV-----NYST-KVKKGDVVLISATG-----M-ESIPLVKELYALC
  670 --MFDPRVRQLAEVLV-----TYST-RVKKGDVVLINASG-----T-DCLPLVKELYSLC
  671 --MKDPRIRQFAEVLV-----DYSA-RVQKGDVVLISCAG-----T-EGAPLVKELYALC
  672 --MKDPRLKQFAEVLV-----DYSA-RVQKDDVVLISCAG-----T-EGAPLVKELYALC
  673 ------------------------------------------------------------
  674 --LTQDQLEKYADVLLWGLTKARAG-EYAAGDVVLLRYDL-----D--ARPLADLLFHKS
  675 ------------------------------------------------------------
  676 ------------------------------------------------------------
  677 ------------------------------------------------------------
  678 ------------------------------------------------------------
  679 -MLTRPQLDKYADVLVWGLLTSRTE-PYKPGDVVLVQYEL-----A--ALKLAEAVYAKL
  680 ---TEIELKKYAQTLWWGLTTARTR-PYAPGDNILLRFDA-----P--ALPLAEAVFDML
  681 ---TKDELKKYAETLWWGLSTARTK-PYQPGDFVLLRFDP-----D--ALPLAEAMFDLL
  682 --LTDEQLDKYVDALWWGLTTARTK-PYEKGDLIMVRYEA-----E--ALPLAEAVFKRL
  683 -MLTDIQLEKYAKVLFWGMQKARVT-PFAPGDIVLVRTDL-----A--ALPLAEKMQSLI
  684 -MFDSMRLEKYADVLIWGLKTSRKK-PFANGDVVLVRFDA-----P--ALPLVEALYGKL
  685 ------------------------------------------------------------
  686 -MLTKKQLSRYADVLVWGMSKARSV-PFKKHDIVVIRYDM-----P--ATALAEVLYEKL
  687 -----ELLKKYAQVFWWGLTTARVD-KYKKGDSILVRYDR-----A--AMETAEVLQAML
  688 YMLTQEILERYADVLVWGLTTARKE-KFKKGDIVLIQFDL-----P--ALRLAEMLYAKL
  689 -MYDAETLGKYADVMLWGLARGRRA-PLRKSDIVLVRFDL-----P--GLPLAEELCGRL
  690 ------------------------------------------------------------
  691 -MFDQTTLERYAAVLLWGLERGRGH-PYRKSDFVLVRFDL-----P--ALPLAEEICARL
  692 PVFTPDELEKYAEVLLWGLKRGKKS-PLAKSSFILVRYHL-----P--ALPLAEELCALL
  693 ---SKEILEKYADVMI-NFALNSGE-GVKPGEVVQLRVPE-----V--AKPFLVALRRAV
  694 -MGIDKELYKACETAL-----KQCM-GVKPGETVLVIADE-----P--EREIGYHLWMKA
  695 ----------ARNALV------SCL-RIQPEEKVTLITDQ-----A--CLEIGASLAAEL

        5         6              7                            8   
      8901234567890ABCDE1234567890123A45ABCDEFGHIJKLMNOP678AB90123
                                                                  
                                                                  
    1 YEAGAKEVIVHWG-----DDEVARLRYEYAP-ME----------------VFE--NVPKW
    2 YEAGAKEVIVHWG-----DDEVARLRYEYAP-ME----------------VFE--NVPKW
    3 YQAGAKDVIVFWN-----DVKTSRLRYDNVS-LE----------------VLG--EIPNW
    4 FDRGAADVAIRYN-----DERLSRMRYDHAD-LE----------------ALT--TIPAW
    5 YKAGARDVSINYS-----DEKFSKIRYTHAD-LD----------------VFK--EVPDW
    6 YQEGARDVVIQWR-----DELFSKIRYLHAP-EE----------------IFE--EFPEW
    7 YQEGARDVVIQWR-----DELTSKIRYLHAP-EE----------------VFE--EFPTW
    8 YLEGARDVVIQWR-----DELFSKIRYLHGP-EE----------------IFD--EFPEW
    9 YQEGARDVVIQWR-----DELFSKIRYLGGP-EE----------------IFA--EFPDW
   10 YREGARDVIINWK-----DELFSKIRYIYAP-EE----------------VFD--EFPDW
   11 FQEGAKDVVIFWG-----DELTSKIRYLHGP-EE----------------IFD--EFPAW
   12 YQEGAKDVVIFWG-----DEISSKTRYLHGP-DE----------------IFD--EFPEW
   13 YQEGARDVAIFWQ-----DELMSKIRFLHAP-DD----------------IFD--DFPEW
   14 YAQGARDVVISWK-----DELFGKIRFLQAP-EE----------------VFS--EFPEW
   15 YKEGAREVIINWR-----DELSSKIKYLHGK-DE----------------IFD--EFPSW
   16 YKEGARDVIINWS-----DELSTKIKYLNGK-DE----------------IFD--EFPNW
   17 YDVGAREVVMRWS-----DELSTKMKYLHAD-DE----------------VFD--EFPDW
   18 YDNGAKDVIINWN-----DELFSKIRFLKAP-KE----------------VFE--EMPPW
   19 YEKGAKDVVVQWN-----DEICGKIKYEHSP-LE----------------VFE--NFPDW
   20 YKNGAKEVIVHWN-----DEICGKYKYLYGA-EE----------------LFE--NYPQW
   21 YKNGAKEVIVHWN-----DEICGKYKYLYGA-EE----------------LFE--NYPQW
   22 YKNGAGEVVVHWN-----DELCGKYKYMYGV-EE----------------LFE--NYPQW
   23 YEFGASEVVVHWS-----DEVCGKYRYLYGA-EE----------------IFD--IFPNW
   24 YDAGAKNVHVKWN-----DEELSLIKYMKAP-FE----------------TFE--EFPTW
   25 YDAGAKNVHVKWN-----DEELSLIKYMKAP-FE----------------TFE--EFPAW
   26 YDEGAKNVHVEYR-----DEELALVKYLNAP-FE----------------AFK--EAMQW
   27 YEAGAINVIVRYN-----DEKLSLIKFNKAS-ME----------------SFE--KEPIH
   28 YEAGAINVIVDYN-----DEELALIKYNKAP-ME----------------SFK--REPKH
   29 FAAGAHDVVVSWS-----DEQLAHIRYAGGK-KA----------------LFT--EFPEW
   30 FAAGAHDVVMSWG-----DELSAHIRFENGK-RE----------------LFT--EFPEW
   31 YDAGAHDVTVAWN-----DERLARLRYDKAK-KS----------------VFS--EFPEW
   32 YDVGAYDVAVNWN-----DEEFSHIRFQKAN-EE----------------RFR--EFPAW
   33 YDAGAYDVAVNWN-----DEEFAHIRFQKAA-SE----------------RFK--EFPAW
   34 YCAGAHDVTVNWS-----DEEFSHIRFRQAP-AA----------------RFR--EFPAW
   35 YNAGAHDVAVNWS-----DEEFSHIRFRQAP-AA----------------RFR--EFPAW
   36 FCAGAYDVSVNWN-----DEVFSHIRYKNAP-LE----------------RFR--EFPAW
   37 FCAGAYDVSVNWN-----DEVFSHIRYKNAP-LE----------------RFR--EFPAW
   38 FAAGAYDVAVHWS-----DEAFERIRYQNAP-ME----------------RFE--EFPAW
   39 FAAGAYDVAVHWS-----DEAFERIRYQNAP-ME----------------RFE--EFPAW
   40 YKYGASDVVINYN-----DEKFNKIRFNNSS-KE----------------ILS--ITPKF
   41 YKAGASDVVINYN-----DEKFNKIKYEYTS-EE----------------VLS--FTPEF
   42 YNSGAKDVYINYS-----DASFNKIKLINSS-KE----------------ILS--EVYGF
   43 YKEGAKEVVVHYG-----DQKLQRLKLEYAS-MD----------------TLK--EVPNW
   44 YKVGAKKVIVEYS-----DEQIGKLTYTYAS-EE----------------TLG--DFPAW
   45 YDAGCREVVMNWG-----DDALVRMKYLRAE-EY----------------VLD--HVPLW
   46 YAAGAKNVHVEWG-----DELMTLLKLTHAP-EE----------------GLE--DFPIW
   47 YDAGAKNVLVEYS-----DERLTRLKMEKAP-EE----------------GLR--DFPTW
   48 YEAGARNVYVEWS-----DEALTRLRLSLAP-EA----------------SLH--TFPTW
   49 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   50 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   51 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   52 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   53 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   54 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   55 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFA--EFPSW
   56 ------------------------------------------------------------
   57 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFS--EFPSW
   58 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFS--EFPSW
   59 YKSGAKHVYVDWN-----DETLTRLKFDLAP-EE----------------AFS--EFPSW
   60 YKSGAKHVYVDWN-----DEVLTRLKFDLAP-EE----------------AFS--EFPAW
   61 YKSGAKHVYVDWN-----DEVLTRLKFDLAP-DE----------------AFS--EFPAW
   62 YEAGAKSVDVDWH-----DDHLVRLKYEKAD-ES----------------VFN--EFPAW
   63 YEKGAKNVTVNWQ-----DDEVAKLKYELAP-FE----------------AFE--EYPEW
   64 YEKGAKNVTVNWQ-----DDEVAKLKYELAP-FE----------------AFE--EYPEW
   65 YEKGAKHVTVNWQ-----DDEVSRLKYELAP-PE----------------AFD--EYPEW
   66 YEKGAKNVTVNWQ-----DDELSRLKYEMAP-FE----------------AFE--EYPEW
   67 YEKGAKNVTVNWQ-----DDELSKLKYEMAP-FE----------------AFE--EYPEW
   68 YQRGAKNVTVRWQ-----DDEVTRLKYELAP-AE----------------AFE--EFPEW
   69 YQRGAKNVTVRWQ-----DDEVTRLKYELAP-AE----------------AFE--EFPEW
   70 YQRGAKNVTVRWQ-----DDEVTRLKYELAP-AE----------------AFE--EFPEW
   71 YERGAKNVHIRWS-----DGVLARLKYEHAP-QD----------------VFE--QFPEW
   72 YETGAANVVVNWS-----DDTVTRLKYDLAP-EE----------------SFT--EYPEF
   73 YEAGAHNVVVNWS-----DDAVTRTKYDLAP-DE----------------SFS--EYPEW
   74 YENGAENVIVNWN-----DDVVSRLKYDLAS-DE----------------AFN--EYPKW
   75 YETGADNVVVNWS-----DDIVTRIKYDLAP-DE----------------AFL--TYPKW
   76 YETGAKHVYVNWN-----DDTVNLYKYDLAP-DE----------------AFT--EFPEW
   77 YEAGAKHVYVDWH-----DDAISRMKYELAP-DE----------------AFD--DYPIW
   78 YEAGAKHVHIDWT-----DDELTRMKYDLAP-DE----------------AFR--EYPQW
   79 YEVGAKQVFVDYT-----DDQITRSRYELAP-ED----------------SFD--FFPPW
   80 YETGAKQVYVDWT-----DDTITRLRFELAP-ED----------------SFS--QFPAW
   81 YEAGARQVFVDWV-----DDVVTRLRYEKAP-AD----------------SFS--DFPSW
   82 YKNGAKQVFVDLS-----DDELVRARYEGAP-KD----------------SFD--FFPPW
   83 YENGAKQVFVDLS-----DDELVRARYEGAP-KD----------------SFD--FFPPW
   84 YKNGAKQVFVDIS-----DDELVRARYEGAP-KD----------------SFD--FFPPW
   85 YEAGASNVHVDWI-----DEELSRLKYEKAA-DE----------------MFT--EYPEY
   86 YEAGSANVQVDWS-----DEALTRLKYEHAP-DE----------------LFT--RFPEW
   87 YLAGASNVHVDWT-----DDSLSRLKYEKAA-DE----------------VFT--RFPEW
   88 YQAGAANVHMEWT-----DEVTSRLKYEKGA-DR----------------IFS--EYPEW
   89 YEAGARLVKILWT-----DETITRLQFEKAA-DD----------------VFT--EAPKW
   90 YEAGARLVKILWT-----DETITKLQFEKAA-DD----------------VFT--EAPKW
   91 YEAGARLVKILWT-----DETVTRLQFEKAA-DD----------------VFT--EAPKW
   92 YEAGARLVKIMWN-----DEAITRLQFEKAA-DD----------------VFT--EAPKW
   93 YTVGAKLVKVKWS-----DETITRLQYELAP-DE----------------TFN--IPPKW
   94 YTAGAKLVTVKWS-----DETITRLQYELAP-DE----------------TFN--IAPKW
   95 YTVGAKLVKVKWS-----DETITRLQYELAP-DE----------------TFN--IPPKW
   96 YEAGARFVKVNWS-----DDVVTRLRYDMAA-EE----------------SFL--DEPKW
   97 YEEGAYLVKVNWT-----DDTITRLRYDMAP-EE----------------SFL--EEPKW
   98 YETGAKQVKVNYS-----DEIVNRIRYDLAP-DE----------------VFL--EPPTY
   99 YETGAKQVKVNYS-----DEIVNRIRYDLAP-DE----------------VFL--EPPTY
  100 YEIGAKLVKVNYS-----DEVVNRIRYDLAP-DE----------------SFL--EPPKY
  101 YEIGAKQVKVNYS-----DEIVSRIRYELAP-DE----------------AFL--EPPKY
  102 YEAGAKLVQIEWS-----DEQVTRIRYDKAP-DE----------------SFE--YFPGW
  103 YEAGAKHVQVIWD-----DEQITKTKYELAP-DE----------------AFN--EFPEW
  104 YEAGAKNVHVEWS-----DEELTRTKFHLAP-DE----------------AFH--EYPAW
  105 YEAGAKHVRVEWS-----DEELTKMKFELAP-DE----------------AFD--EYPNW
  106 YEVGAKNVHVEWN-----DDELTRLKYDLAP-FE----------------AFK--EAPAW
  107 YEQGAKNVHVEWH-----DDDLTRIRYDMAP-LE----------------SFH--EFPEW
  108 FEVGAEDVIMDWR-----DEVLGALRYKNAP-MR----------------VFE--SAPLH
  109 FEVGAEDVIMDWR-----DEVLGALRYKNAP-MR----------------VFE--SAPLH
  110 FEVGAEDVIMDWR-----DEVLGALRYKNAP-MR----------------VFE--NAPLH
  111 ------------------------------------------------------------
  112 FEVGAEDVIMDWR-----DEELGALRYKNAP-LR----------------VFE--SAPVH
  113 ------------------------------------------------------------
  114 FEVGAEDVIMDWR-----DEELGALRYKNAP-LR----------------VFE--SAPVH
  115 FEVGAEDVIMDWR-----DEELGALRYKNAP-LR----------------VFE--SAPVH
  116 FEVGAEDVIMDWR-----DEELGALRYKNAP-LR----------------VFE--SAPVH
  117 FEAGAKDVIINWS-----DSEVTALRYNNAP-LA----------------VFE--TPDKH
  118 FQVGALDVIVNWV-----DEDITLERYKKAP-LS----------------VFE--TAPKY
  119 YAAGAKQVFVNWS-----DEETGKIRYFNAP-AD----------------SFK--EFPDW
  120 YEVGASNVYVQWS-----DDEMTKIRYFDAP-ED----------------SFD--AFPDW
  121 YETGAKHVYVEWN-----DEALTYIKFHHAP-EE----------------AFS--EYPMW
  122 YETGAKHVYVEWN-----DEALTYIKFHHAP-EE----------------AFS--EYPMW
  123 YETGAKHVYVEWN-----DEALTYIKFHHAP-EE----------------AFS--EYPMW
  124 YETGAKHVYVEWN-----DEALTYIKFHYAP-EE----------------AFS--EYPMW
  125 YETGAKHVYVEWN-----DEALTYIKFHYAP-EE----------------AFS--EYPMW
  126 YETGAKHVYFEWN-----DEALTYIKFHHAP-EE----------------AFS--EYPML
  127 YETGAKHVHVDWD-----DESLTYIKFQHAP-EE----------------SFS--EYPMW
  128 YETGAKHVHVDWD-----DESLTYIKFQHAP-EE----------------SFS--EYPMW
  129 YEAGAKHVYVEWH-----DEDLTYIKFKHAP-DE----------------AFL--EYPTW
  130 YEAGAKHVYVEWH-----DEDLTYIKFKHAP-DE----------------AFL--EYPTW
  131 YEVGAKHVYVEWN-----DEDLTYIKFKYAP-DE----------------AFL--EYPMW
  132 YEAGAKHVHVEWS-----DEEITYIKFKHAP-EE----------------ALH--EYPSW
  133 YEAGAKNVMVEWN-----DEELTRIKYKMAP-ME----------------AFH--EYPMW
  134 YGKGAKNVHVEWG-----DEVLSYLKMKNAP-ME----------------VLE--NFPKW
  135 YELGAKDVHINWA-----DDELTLLKYENAP-DE----------------VIE--DFPEW
  136 YELGAKDVHINWG-----DDDLTLWKYQYAP-DE----------------VLG--DYPEW
  137 YELGAKDVHINWM-----DDELTLLKYQYAP-DE----------------VIE--HYPDW
  138 FEMGAEDVHINWS-----DDELTRMKYEYAS-QE----------------TLS--EVPEW
  139 YEAGAKHVYVEWD-----DDELKRLKYERAP-DE----------------AFH--EYPQW
  140 YEEGAKRVHVEWQ-----DEQLTKLTYGLAP-DE----------------AFE--QYPAW
  141 YEAGAYQVKVFWH-----DDAVSRIHYDLAS-LE----------------SFL--EEPKW
  142 YKAGAGRVHVNFS-----DDEMDRAYFEHAS-DE----------------EFN--RFPEW
  143 YKAGAGRVHVNFS-----DDEMDRAYFEHAS-DE----------------EFN--RFPEW
  144 YKAGAGRVHVNFS-----DDELDRAYFEHAS-DE----------------EFN--RFPEW
  145 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  146 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  147 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  148 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  149 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  150 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  151 YKAGAGRVHVNFS-----DEEMERAYFDYAS-DE----------------EFN--RFPEW
  152 YEAGASRVHVNLT-----DASFERAYYENVT-VE----------------ETA--NFPKW
  153 YEAGAKRVQVNYE-----DPVLTRTHFELAP-ED----------------AFK--EFPQW
  154 YEAGAKYVQVQWD-----DEEVTRNRFLYAP-DE----------------SFD--YYPQW
  155 YEAGAKFVEVNWS-----DEQTTRIRYESAP-DE----------------SFD--FYPEW
  156 YDAGAKYVQVDWE-----DEKITRIRYEKAP-ED----------------SFH--YYPQW
  157 YDAGAKYVQVDWE-----DEKITRIRYEKAP-ED----------------SFH--YYPQW
  158 YDAGAKYVQVDWE-----DEKITRIRYEKAP-DD----------------SFG--YYPQW
  159 YDAGAKYVQVDWD-----DERVTRIRYEHAP-AN----------------SFG--YYPQW
  160 YEAGAKYVQVEFE-----DDSITRSRFEHGD-EA----------------SFD--YYPAW
  161 YEAGAKYVQVEFE-----DDQITRSRFEHGD-EA----------------SFD--YYPAW
  162 YEAGAKYVQVEFE-----DDQITRSRFEHGD-DA----------------CFD--YYPAW
  163 YEAGAKYVQVEFE-----DDSITRSRFEHGD-EA----------------RFD--YYPAW
  164 YKCGAKNVYIEWS-----DEESTLIKYLYAP-DE----------------AFH--EFPKW
  165 YKAGAKNVHIEWS-----DEKCSLIKYLNAP-DE----------------AFE--EFPRW
  166 YECGAKHVYVEWS-----DDECSKLTYNMAP-DE----------------SFN--EYPQW
  167 YKAGAKQVYVEYS-----DGVITREKYMSAP-ND----------------AFD--EYPQW
  168 YKAGAKHVYVEYS-----DEAITREKYLNAP-SQ----------------AFD--EYPEW
  169 YQAGAKRVYFNWT-----DDRLDHLRLKYAA-ED----------------VIG--DYPVW
  170 YQAGAKDVTMRWG-----DDETERLRLQRAP-EE----------------ALK--QIPNW
  171 YALGAAEVIVQWT-----DDVVQKEFLAHAD-SD----------------RLE--TIPQY
  172 YALGAAEVIVQWT-----DDVVQKEFLAHAD-SD----------------RLE--TIPQY
  173 YELGADEVIVQWT-----DDVVQKEFLAHAA-ED----------------RLS--TIPQH
  174 YRLGAAEVIVQWS-----DETIQREFLAHAA-TD----------------RIE--NVPQY
  175 YRLGAAEVIVQWS-----DETIQREFLAHAA-TD----------------RIE--NVPQY
  176 YRLGAAEVIVQWS-----DETIQREFLAHAA-TD----------------RIE--NVPQY
  177 ------------------------------------------------------------
  178 YRLGAAEVIVQWS-----DETIQREFLAHAA-TD----------------RIE--NVPQY
  179 YKLGAAEVIVQWT-----DDQIQREFLLHAA-TD----------------RIE--NVPQS
  180 YELKAAEVIVEWS-----DEIIQKEFLAHAS-FD----------------RIE--NFPQY
  181 YALGAAEVIVQWT-----DDAIQRSFLTHAE-DD----------------RLA--IVPQY
  182 YALGATEVIVKWA-----DDVVNREQFIGTP-QD----------------RLT--AIPQY
  183 YALGATEVIVKWA-----DDVVNREQFIGTP-QE----------------RLT--DIPQY
  184 YEKGAREVIVDWS-----DDPLSRLSFEYQS-KE----------------TLT--DVPDY
  185 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  186 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  187 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  188 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  189 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  190 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  191 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  192 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  193 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  194 YALGADEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  195 YALGAHEVIVQWT-----DDVINREKFLHAP-ME----------------RLD--NVPEY
  196 ------------------------------------------------------------
  197 YALGAHEVIVQWT-----DDVINREKFLHAP-MD----------------RLD--NVPEY
  198 YALGAHEVIVQWA-----DDFVNREKFLHAP-LE----------------RLD--NVPEY
  199 YALGAHEVIVQWA-----DDFINREKFLHAP-ME----------------RLD--NVPEY
  200 ------------------------------------------------------------
  201 YALGAHEVIVQWT-----DDLVNREKFLHAP-ME----------------RLD--NVPDY
  202 YALGAHEVIVQWA-----DDFTTREKFLHAP-MD----------------RLD--NVPDY
  203 YALGAHEVIVQWA-----DDFTTREKFLHAP-MD----------------RLD--NVPDY
  204 YALGAHEVIVQWA-----DDFTTREKFLHAP-MD----------------RLD--NVPDY
  205 YALGAHEVIVQWA-----DDFTTREKFLHAP-MD----------------RLD--NVPDY
  206 YALGAHEVIVQWA-----DDLTTREKFLHAP-ME----------------RLD--NVPDY
  207 YALGAHEVIVQWA-----DDLSTREKFLHAP-MD----------------RLD--NIPDY
  208 YALGAHEVIIQWA-----DDFTTREKFLHAP-MD----------------RLD--NVPDY
  209 YALGAHEVIIQWA-----DDFTNREKFLHAP-ME----------------RLD--NVPDY
  210 YALGAHEVIVQWA-----DDLSTREKFLHAP-ME----------------RLD--NVPDY
  211 YALGAHEVIVQWA-----DDLSTREKFLHAP-MD----------------RLD--NVPDY
  212 YALGAAEVIVQWS-----DDIINRERFLHAD-MD----------------RIE--EVPAY
  213 YALGAAEVIVQWS-----DDIINRERFLHAG-MD----------------RIE--EVPAY
  214 YALGAAEVIVQWS-----DDIINRERFLHAD-MD----------------RIE--EVPDY
  215 YALGAAEVIVQWS-----DDTINRERFLHAE-MN----------------RIE--EVPAY
  216 YALGAAEVIVQWS-----DDTINRERFLHAE-MN----------------RIE--EVPAY
  217 YAHGAKEVLVNWL-----DDVIARERLVNVD-VE----------------LLE--QVHPQ
  218 YQLGASEVIVQWS-----DDEINRDRLLYAA-ED----------------RIT--TVPEY
  219 YQLGASEVIVQWS-----DDEINRERLLYAA-ED----------------RIT--TVPEY
  220 YALGAEKVIVEWS-----DDEITKQHYLNQP-QE----------------VLT--HIPDY
  221 YQAGAAEVVVDYI-----DDKIARQRLLHAD-YE----------------RLV--NVPDY
  222 YKAGAAEVVIDYI-----DDKIARQRLLHAD-YE----------------RLI--NVPNY
  223 YEAGAAEVFVDYI-----DDTITREKLINAD-YE----------------RLV--NVPDF
  224 ------------------------------------------------------------
  225 YEAGAAEVIVDYT-----DDQITREKLLKAD-ED----------------RLL--NVPDY
  226 YEAGAAEVVVDYT-----DDAITRQRLLHAD-EE----------------RLL--NVPDY
  227 YQAGAAEVVIDYL-----DDRIAKERLLHAD-YE----------------RLV--TVPDY
  228 YEAGAAEVFVDYN-----DDQITREKLLKAD-ED----------------RLL--QVPDY
  229 YESGAAEVVVDYI-----DDSITKDKLLYAD-HD----------------RLI--NVPQY
  230 YEKGASEVIVDYT-----DDFITRQRLLHAS-DE----------------VLT--NVPQY
  231 YQAGAAYVKVNWS-----DDALSRLNYTYRS-LE----------------NLQ--EVPQY
  232 YEAGATDVHIQWS-----DDQIARLNFQNQT-ID----------------QLK--EVPDY
  233 YEAGAAHVAVDFS-----DDTLTRLKYEHES-TE----------------TLC--EVPDY
  234 YENGARRVHFTWK-----DDYTTRLDYEYQT-TE----------------DLA--EVADY
  235 YAAGASEVMIKWS-----DTFTSRQFLEFAN-QE----------------RLE--NIPDY
  236 YAAGASEVMVKWS-----DTFTSRQFLEFAN-QE----------------RLE--NIPDY
  237 YAAGANEVIVKWN-----DTFTSRQFLAHAS-EE----------------RLE--NIPAY
  238 YRAGASEVMIEWK-----DTFSERAFLKHAS-EE----------------RLE--NVPEY
  239 YQAGAADVMVKWD-----DTFVSQQFLEHAS-EE----------------RLA--NVPQY
  240 YETGAGRVFVKWR-----DDFINRKFIENAS-DE----------------FLN--DMPDW
  241 YQRGAAEVQVQWF-----DDVLKRLDMAHMA-NE----------------RLF--NIPAF
  242 YQRGAAEVQVQWS-----DDTLKRLDMAHMA-ED----------------RLF--NIPPF
  243 YDRGAAEVQVQWH-----DDLIKRLDMAHMA-TS----------------RLY--NIPDF
  244 YDRGAAEVQVQWH-----DDLIKRLDMAHMA-TS----------------RLY--NIPDF
  245 YDRGAAEVQVQWH-----DDLIKRLDMAHMA-TS----------------RLY--NIPDF
  246 YDLGAAEVIIKWQ-----DDDIDRINMQHKA-ED----------------RLV--NVPDF
  247 YDLGAAEVIIKWQ-----DDAIDRINMQHKA-QE----------------RLV--DVPDF
  248 YQRGAAEVIVNWQ-----DTATQQAFIAHAA-TE----------------RLT--TVDQV
  249 YQLGANQVIVEWQ-----DTMLKREFLKHAS-EA----------------TLT--NIPAW
  250 YALGANQVIVEWK-----DTILQREFLTHAS-EA----------------TLI--NIPAW
  251 YKRGANNVMIEWQ-----DIHVQREFLQHAN-ND----------------SLT--NIPTW
  252 YQKNAAQVQIEWN-----DQYLTHELIKHSN-PD----------------KLS--IVPTS
  253 ------------------------------------------------------------
  254 YEAGAREVVMEWS-----DQAITKSFLSHAP-ID----------------RLE--NVPEY
  255 YEAGAREVVMEWS-----DQTIAKAFLDHAP-ED----------------RLT--TVPNY
  256 YQAGAREVVLEWS-----DQQITKDFLTYAP-AD----------------RLE--NIPAY
  257 YQAGAREVVLEWS-----DQQITKDFLTYAP-AD----------------RLE--NIPAY
  258 YKAGAHEVVMEWS-----DQTISKEFLNHTS-LD----------------RLK--EVPNY
  259 YRAGAHEVVLEWS-----DQQINKAFLTHTS-LE----------------RLA--NVPEY
  260 YLAGAKQVIVEWS-----DQLITQMNINAAD-EE----------------LLT--TTPQY
  261 YQAGAVQVQVQWH-----NALETREFYLHAS-PA----------------VIS--ETPEY
  262 YQLGAEEVLIEWH-----DIEATKQLLLNAS-VD----------------TLK--RIPQY
  263 YALGAADVILEWS-----DIETTRQFLMHAS-EA----------------RIG--QVFDY
  264 YQVGASDVHVKLT-----DDKLSRLHAEYQS-KE----------------VYS--HIPQW
  265 YQVGASDVHVKLT-----DDKLSRLHAEYQS-KE----------------VYS--HIPQW
  266 YKAGASDVHVKLT-----DDRLTRMHAEYQP-TE----------------VYS--HVPQW
  267 YEAGASDVKVNYS-----DDKLAQLNFKYRK-QE----------------SFE--SVPQY
  268 YKAGASDVRVKYS-----DSKLKRLKFEHEA-VE----------------YFENSDLKQY
  269 YKAGASDVRVKYS-----DSKLKRLKFEHES-VE----------------YFENSDLKQY
  270 YKAGASDVRVKYA-----DARLKRLKFEHES-VE----------------HFENNELKQY
  271 ------------------------------------------------------------
  272 YKAGAEDVRVSYT-----DPKLKRLKFENES-VE----------------HFEKQELKQY
  273 YKAGAEDVRVSYT-----DPKLKRLKFENES-VE----------------HFEKQELKQY
  274 YQEGASDVRVVYT-----DPILERLKYENEA-VD----------------YFENHAVKVY
  275 YIAGASDVRVEYA-----DPRLKRLKFEHES-LD----------------HFENNDVKSY
  276 YIAGASDVRVEYA-----DPRLKRLKFEYES-LD----------------HFENNDVKSY
  277 YKAGASDVKVNYS-----DSKLNRLKFEYES-VD----------------YFENQAVKSY
  278 YHCGASDVRVVYS-----DPTLKRLKFENES-VE----------------HFANHEIKSY
  279 YHCGASDVRVVYS-----DPTLKRLKFENES-VE----------------HFANHEIKSY
  280 ------------------------------------------------------------
  281 YHCGASDVRVVYS-----DPTLKRLKFENES-VE----------------HFANHEIKSY
  282 YKCGASDVRVAFN-----DPTLNRLKFEYEQ-VE----------------FFANNAIKSY
  283 YLLGASDVRVVYT-----DPTLTRLKFEHES-VD----------------YFKNTELKAY
  284 YKNGASDVRVEYS-----DPTLKRLKYENEP-ET----------------YFMTNDVKQY
  285 YQRGASDVKVEYS-----DDRLSRLKFEYET-VE----------------HFEKNEVKSY
  286 YKRGASDVKVEYS-----DDKLSRLKFEYES-VE----------------FFEKDAVKSY
  287 YRRGASDVRVNYS-----DDTLKRLRYENEP-VS----------------YFENSAVKDY
  288 YERGASDVRVKYA-----DDALTKLKFKYED-AE----------------FFAEKSLKPY
  289 YAAGASDVRVKYE-----DPQVKRLTYENEP-TS----------------FFE-QEVKDY
  290 YDAGAKKVIVTYF-----DDEVKLLNYTYAP-VE----------------AL---NVPDY
  291 YKSGAKQVNIDWN-----DGVITRMHYENQD-VE----------------VLE--DIPQY
  292 ------------------------------------------------------------
  293 YEKGASEVVMEWN-----DDEINRMYYENAS-EE----------------ALK--DVPDF
  294 ------------------------------------------------------------
  295 YEKGCSEVIMEWN-----DDAINRMYYENAS-EE----------------ALK--DFPDF
  296 YKAGAGNVNVVWR-----DDIITRRKFEYAS-IE----------------TLS--EVKQW
  297 YKAGAGDVNVVWR-----DDIITRRKFEYAS-IE----------------TLS--EVKQW
  298 YKAGAGDVDVIWR-----DDIITRRKFEYAN-IE----------------TLS--EVKKW
  299 YEEGAREVEVLWN-----DEKLTQLNYHYMS-QE----------------NLS--KVSKT
  300 FEAGAKDVFVNYS-----DQNLAKIRYNNAS-IE----------------TLS--DIPQY
  301 YAAGATDVKIHYN-----DQKFTKLKYQKSP-LE----------------VLT--TVPDY
  302 YDFGAHKVNVEWS-----DDEIGRIRYERTP-IE----------------CLK--EIPQY
  303 YEEGAKKVQVDYS-----DENITKLKYTYES-EE----------------TLS--QVPEF
  304 YEEGAKKVQVDYS-----DENITKLKYTYES-EK----------------TLS--QVPEF
  305 YELGAGEVVVDYR-----DQLISRLKYENES-LD----------------VLT--DIPKH
  306 YDLGAKKVEIEWR-----DQELTKLHLKYQS-ED----------------TLS--SVGQW
  307 YELGAKRVSVEWR-----DQELTKLNLKYQS-EE----------------SLS--TVGQW
  308 YELGASKVEVEWR-----DQELTKLNLTYQS-EE----------------SLS--NVSQW
  309 YEKGARNVAIDWK-----DDELTRLTYEYQD-QE----------------TLN--EVADW
  310 YEKGARNVAIDWK-----DDTITRLTYEYQD-QD----------------TLN--EVPDW
  311 YEKGARKVSINWV-----DDTLTRLSYEYES-QD----------------TLN--EVPDW
  312 YEKGARLVSINWK-----DEELTKLKYTYEN-QE----------------TLN--EVPDY
  313 YEKGSRLVSINWK-----DEELTKLKYTYED-QE----------------TLN--EVPDY
  314 YEKGARLVSINWK-----DEELTKLKYTYED-QE----------------TLN--EVPDY
  315 YDAGASYVHIDWG-----DEWWLRETVKRAD-LA----------------ILR--HRAKW
  316 YEAGAKFVHVDWG-----DEWWVRETILRGD-LE----------------TFK--SRARH
  317 YQAGAKEVLVFYK-----DDYVSKQHYQYQD-EE----------------TLC--TVRPW
  318 YQAGAKEVLVFYK-----DDYVSKQHYQYQD-EE----------------TLC--TVRPW
  319 YQAGAKEVLVFYK-----DDYVSKQHYQYQD-EE----------------TLC--TVRPW
  320 YQAGAKEVLVFYK-----DDYVSKQHYQYQD-EE----------------TLC--TVRPW
  321 YQAGAKEVLVFYK-----DDYVSRSHYRYQD-EE----------------TLS--TVRPW
  322 YAAGAKEVVVFYQ-----DDMNRRQTYLHAD-EE----------------TLC--NVREW
  323 YAAGAKEVVVFYQ-----DDMNRRQTYLHAD-EE----------------TLC--NVREW
  324 YKAGAKEVVVTYR-----DETIDRFHYQYQD-LD----------------TLT--TVRDF
  325 YRAGAGEVIVQWL-----DDQITKLDYQYAE-TP----------------VLQ--RVPDW
  326 YAVGAREVIINWT-----DTELAKLNYTYQS-EE----------------TLA--DIPDW
  327 YEAGASNVIVDWS-----DEKLTRYQFQYQN-LE----------------ELK--NIPDW
  328 YAAGAKKVVIKFG-----DDHIAKMHVQNQD-IE----------------TLT--DIPQW
  329 YIAGAKKVHIIWG-----DEIVSKHSYDYAT-TE----------------NLK--EMPQW
  330 FEIGAFDVYVKWS-----DEIITKTRLKNAP-ID----------------ALK--EFPEW
  331 FELGAYDVYVKWN-----DEVVTKHRLKKAS-ID----------------ALK--EYPEW
  332 YEAGAKEVYVRYS-----DEYITFLKLKNAP-EE----------------IIE--EVHSW
  333 YDLGAKEVLVVWN-----DTYITRQKLLKAP-ED----------------VIT--NVYNW
  334 YNVGASEVIVIWN-----DTYVSKQTLLKSP-EE----------------VLT--NVYNW
  335 YSLGAKEIYYRWY-----DDELSLIRYNNAP-DS----------------VFD--TFPKW
  336 YESGASQVVLNWR-----SNALTRLKYDHEE-LA----------------SFE--DFPTW
  337 ------------------------------------------------------------
  338 YKAGAAQVVFNWY-----CNGTTRLRYEYET-QD----------------KFE--SVPHW
  339 YTAGAAQVVCNWR-----SDAMARLRYEHED-QQ----------------YFE--SLPDW
  340 YKAGASQVIMDWR-----CDPLTRLRYEQEE-VS----------------RFT--EFPSW
  341 YKAGASQVIMDWR-----CDPLTRLRYEQEE-VS----------------LFT--EFPSW
  342 YELGAKEVVLNWR-----CSPIARQRLLHAK-ES----------------VLQ--RPANW
  343 YELGAKEVVLNWR-----CSPIARQRLLHAK-ES----------------VLE--KPANW
  344 YELGAKEVVLNWR-----CSPIARQRLLHAK-ES----------------VLE--KPANW
  345 YQLGAKEVVLNWR-----CSPIARQRLIHAK-ET----------------VLE--KPANW
  346 YQLGAKEVVLNWR-----CSPIARQRLMHAK-ET----------------VLE--KPANW
  347 YQLGAKEVVLNWR-----CSPIARQRLMHAK-ET----------------VLE--KPANW
  348 YQLGAKEVIINWR-----HTPITRQRLLHAD-AS----------------VLE--TPAKW
  349 YALGAKDVHINWR-----STITAKSRLSNVK-DE----------------VLS--NPAPW
  350 YKLGARDVIYDFS-----DDEMTLARYNFAS-DE----------------AFK--QLPQF
  351 YKMGAKDVVYDFS-----DDEMTLARYAYGD-ES----------------IFK--EMPKF
  352 YEAGAKHVEFQLA-----DDEMSIIRYRHGK-DF----------------VFE--SFPQW
  353 YEAGARDVQVNWQ-----DDAVTRIRMELGS-EE----------------ALT--DHKGW
  354 YAAGAKEVVVHYS-----DEKLSRIKMEHTA-VE----------------VLE--DVKPW
  355 YEAGAKRVIVRWE-----DDKLTRLHMELAQ-ES----------------DLC--ELKPY
  356 YREGASLFTVIYG-----DQELARKRLALAP-EE----------------GLD--KAPAW
  357 YREGASLFTVIYG-----DQELARKRLALAP-EE----------------GLD--KAPAW
  358 YEHGASLFTVLYS-----DNVISRQRLSLAP-EE----------------GLD--RAPGW
  359 YREGASLFTVIYG-----DNVLSRKRLSLAP-EE----------------GLD--RAPGW
  360 YENGASLFTVLYG-----DNLIARKRLALVP-EA----------------HLD--RAPAW
  361 YEHGASLFTVLYG-----DNVLSRKRLSLAP-EE----------------GLD--KAPAW
  362 YRAGAALVIPFFA-----DDLIQRARFREAS-ED----------------SFD--FAPAW
  363 YRAGAALVIPFFA-----DDLIQRARFREAS-ED----------------SFD--FAPAW
  364 YQAGAKMVTTLYS-----DDAATLARYRFAP-SD----------------AFD--YAPAW
  365 YKAGSPLVSVLYD-----DEAAHLLRFQHAP-EA----------------SFD--KAPQW
  366 YKAGAALVTTVFS-----DEESTLLRFRHAS-DE----------------SFD--KAPSW
  367 YKAGASLVTTLFS-----DEEATLMRFRNAP-DD----------------SFD--SASGW
  368 YAAGASLVTTLYS-----DDEATLARFAQAP-DD----------------AFD--RAAGW
  369 YRAGASLVTTLYG-----DDAATLARFAHAP-DD----------------AFD--RAAGW
  370 YKAGASLVTTFYA-----DDAATLARFTHAP-DE----------------AFD--RAAGW
  371 YKAGASLVTTFYA-----DDAATLARFAHAP-DE----------------AFD--RAAGW
  372 ------------------------------------------------------------
  373 YKAGAALVTTFYA-----DDAATLARFAHAP-DE----------------AFD--KAAGW
  374 YKAGAGLVTPFFS-----DEDITLSRYRFGP-DA----------------SFD--RAAGW
  375 YRAGAGLVTPFFS-----DEDITLSRYRFGP-DQ----------------SFD--RAAGW
  376 YKAGAGLVMPFFS-----DEDITLSRYRFGP-DA----------------SFD--RAAGW
  377 YKAGAGLVIPLFS-----DDEITLARYRNAP-DA----------------SFD--RAAGW
  378 YKAGAGIVTSFFS-----DEELTLARYRFGH-DN----------------SFD--RAADW
  379 YKAGAGIVTSFFS-----DEELTLARYRYGH-DE----------------SFD--RAADW
  380 YKAGAGIVTSFFS-----DEELTLARYRYGH-DT----------------SFD--RAADW
  381 ------------------------------------------------------------
  382 YKAGAGIVTSFFS-----DEELTLARYRYGH-DN----------------SFD--RAADW
  383 YKAGAGLVTSFFS-----DEELTLARYRFGH-DA----------------GFD--RAADW
  384 YKAGAGIVTPILS-----DEEMTLARYRHGH-DN----------------SFD--RAAGW
  385 YKAGAGIVTPILS-----DEEMTLARYRHGH-DD----------------SFD--RAANW
  386 YKAGAGIVTPILS-----DEEMTLARYRHGH-DD----------------SFD--RAANW
  387 YKAGAGIVTPILS-----DEEMTLARYRHGH-DD----------------SFD--RAANW
  388 YKAGAGLVTPIFN-----DDEMTLARYRFGA-DA----------------GFD--RAAGW
  389 YRAGAGLVTPIFN-----DDEMTLARYRFGA-DA----------------GFD--RAAGW
  390 YKAGAGLVTPIFN-----DDEMTLARYRFGA-DA----------------GFD--HAAGW
  391 YKAGAGLVTPIFN-----DDEMTLARYRFGA-EA----------------SFD--RAASW
  392 YKAGAGLVTPIFN-----DDEITLARFRYGA-DA----------------GFD--RAAGW
  393 YRAGAGLVIPMLS-----DEAITLSRYRFAP-DA----------------SFD--RAAGW
  394 YQAGAGLVSAFYS-----DEDTTLSRYQYGS-DE----------------SFD--RASDW
  395 YQAGAGLVSTFYS-----DEETTLSRYQYGS-DE----------------SFD--RASDW
  396 YQAGAGLVTAFYS-----DEETTLSRYQYGS-DE----------------SFD--RASDW
  397 YKAGAGLVSTFYS-----DEETTLARYEYGH-DE----------------SFD--RAASW
  398 YKAGAGLVTTFYA-----DEETTLARYAHAP-DE----------------SFD--RASDW
  399 YMAGAGLVTTFYA-----DEEATLARYAHAP-DE----------------SFD--RASDW
  400 YKGGAGLVTTFYA-----DEEATLARYAHAP-DE----------------SFD--RASDW
  401 YKAGAGLVTTFYA-----DEEATLARYAHAP-DE----------------SFD--RASDW
  402 YMVGAGLVTTFYS-----DEETTLARYAHGA-DA----------------SFD--RASGW
  403 YLAGAGIVTTFYS-----DEETTLSRYQHGS-DG----------------SFD--KASGW
  404 YIAGGGLVTTFYS-----DEETTLSRYRHAS-DA----------------NFD--RASGW
  405 YIAGGGLVTTFYS-----DEETTLSRYRHAS-DA----------------NFD--RASGW
  406 YLAGGGLVTTFYS-----DEETTLSRYRHAS-DA----------------NFD--RASGW
  407 YLAGGGLVTTFYS-----DEETTLSRYRHAS-DA----------------NFD--RASGW
  408 YKAGAGLVTPFFA-----DDEMALARYENAS-DA----------------SFD--RAASW
  409 YKAGAGLVTPFFA-----DDELALARYENAS-DA----------------SFD--RAASW
  410 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  411 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  412 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  413 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  414 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  415 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  416 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  417 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  418 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  419 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  420 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  421 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  422 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  423 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  424 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  425 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  426 YKAGAGLVTPFFT-----DDAITLARYANAP-DE----------------SFD--RAADW
  427 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  428 YKAGAGLVTPFFA-----DDAITLARYANAP-DE----------------SFD--RAADW
  429 YAAGANVITPILS-----DEAITLARFENGH-DA----------------TFD--KAADW
  430 YKAGAGLVTTLYS-----DEEATLARYKYAN-DD----------------AFD--HAADW
  431 YKAGAGVITPLFG-----DEALSLIRFENAH-SA----------------SFD--RAPSW
  432 YKAGAGVITPLFG-----DEALSLIRFENAH-SA----------------SFD--RAPSW
  433 YKAGAGVITPLFG-----DEALSLIRFENAH-PA----------------SFD--CAPSW
  434 YKAGAGVITPLFG-----DEALSLIRFENAH-SA----------------SFD--CAPSW
  435 YKAGAGVITPILG-----DEALVLMRFENAH-AE----------------SFD--CAPSW
  436 YKVGAGVITPIFS-----DDMLSLTRFENAH-TA----------------SFD--CAPSW
  437 YKVGAGVITPIFS-----DDMLSLTRFENAH-TD----------------SFD--CAPSW
  438 YKVGAGVITPIFS-----DDMLSLTRFENAH-TA----------------SFD--CAPSW
  439 YKAGAGVIIPLFS-----DDMLLLTRFENAH-TA----------------SFD--CAPSW
  440 YEAGASLVTPIFA-----DPGVSLARYGKAG-DE----------------SFD--TAAGW
  441 YEAGASLVTPIFA-----DPGVSLARYGKAG-DE----------------SFD--TAAGW
  442 YKAGASLVTPILS-----DADLTLARFQHGA-DD----------------SFD--TAAGW
  443 YRAGAGLVTPILG-----DEALMLARYRNAP-DD----------------SFD--RAPGW
  444 YKAGASLVTTILA-----DDQMALARYQHAR-EE----------------SFD--HAPAW
  445 YKAGASLVTTLFS-----DDECSLARYRFAA-DG----------------SFD--VAPGW
  446 YKAGAGIVTPFFN-----DDAITLARYEHAP-DE----------------SFD--RAPEW
  447 YKAGAGIVMPFFT-----DEAITLARYEHAE-DA----------------SFD--RAPGW
  448 YKAGASLVTPFYA-----DDVATLARFRHAA-DD----------------TLD--TAADW
  449 YRAGASLVTPFYA-----DDVATLARFRHAA-DD----------------TLD--TAADW
  450 YRAGASLVTPFYA-----DDITTLARFHHAA-DD----------------TLD--TAADW
  451 YRAGASLVTPFYA-----DDAATLARFHHAA-DD----------------TLD--TAADW
  452 YRAGASLVSTFYS-----DDETTLARFRHAP-DD----------------TFD--TAAKW
  453 YRAGASLVTPFFS-----DDEMTLARFRHAP-DA----------------SFD--VAAGW
  454 YKAGASLVTTLYA-----DDETTLARFIHAP-DE----------------AFD--VAPTW
  455 YRAGASLVTTLYA-----DGEATLARYIHAP-DD----------------AFD--TAPTW
  456 YKAGASLVSTFYS-----DEETTLARYKYAA-ED----------------TFD--TAAGW
  457 YKAGASLVSTFYS-----DEETTLARYKYAA-ED----------------TFD--TAAGW
  458 YKAGASLVSTFYS-----DEETTLARYKYAA-ED----------------TFD--TAAGW
  459 YKAGASLVTTFYS-----DAEATLARYRYAQ-DE----------------TFD--TAAEW
  460 YRAGAKIITPLYT-----DPEVVLARYRYAT-KD----------------SFE--KATNW
  461 YEAGASLVTTLLS-----DEASTLLRYRHGK-DA----------------SFD--KAAGW
  462 YKAGASLVTTLYS-----DDEAVLARYHHAP-NE----------------AFD--KAPKW
  463 YKAGALLVTTTYG-----DDQAILSRYKYAN-DA----------------SFD--YAPVW
  464 YKAGANLVTTLYS-----DDETTLARYKYAP-DS----------------SFD--FAAQW
  465 YKAGAKLVTVFYT-----DDATTLARFQHAP-DA----------------SFD--YAPQW
  466 YKLGAGLVSVFYT-----DSESSLMRYRYGA-PH----------------AFD--RSADW
  467 YMLGAGLVSVFYK-----DSEATLMLYKYGA-DY----------------AFD--RVADW
  468 YMLGAGLVSVFYK-----DSEATLMLYKYGA-DY----------------AFD--RVADW
  469 YKAGSRLVVTQFY-----DEQLSLARYRYAP-RD----------------SFE--EYATF
  470 YAAGASFVDVRWD-----DDDIQLARFELAP-EG----------------SFE--QISRW
  471 YAAGASFVDVRWD-----DDDVVLARFELAP-ED----------------SFE--TLSRW
  472 YDAGASFVDVRWD-----DDDVQLARFTLAP-EG----------------TFG--QISRW
  473 YAAGARFVDVRWD-----DDDVQLARFELAP-DG----------------TFE--EISQW
  474 YAAGASFADVRWD-----DDAVVLARFQDAP-DG----------------TFE--TISQW
  475 YDAGASFVDVRWD-----DDAVNLLRYQKAP-DG----------------SFE--QLSRW
  476 YKRGVRYVHPVYN-----DDGVTLARFRYAP-RD----------------SFD--LYPSW
  477 YRAGALDVRVRYV-----DDHLDLALYEDGG-DD----------------AVA--YVPEW
  478 YRAGALHVKVNYV-----DQMLSLALFEDGS-DE----------------AVA--FLPEW
  479 YRAGAADVRVGYR-----DDHLDRALYEDGS-DA----------------AVD--FLPEW
  480 YRAGALDVRVEYH-----DEHLALALYEDGS-DE----------------AMG--FLPPW
  481 YRTGALDVRVDWR-----DDQLERLRYTEGS-RE----------------AAL--FIPEW
  482 YRAGAAEVDVRYV-----DEHLDRSRLTDGQ-DG----------------AVA--FVPEW
  483 YRLGARAVVVDLH-----DPVLGRIGLEEVR-EA----------------YLD--EVPDW
  484 YRAGAPLVTCLYE-----DPSLIRARFDHGA-DE----------------ALD--CAPGW
  485 YLNGAHYVYIKWI-----DEELARIEYEYMT-EQ----------------GLA--YTPDW
  486 YKVGASYVYVEWV-----DQPSTAAMLTYAD-VN----------------AL---ELPAF
  487 FDVGAKDVIVRYS-----DDEINRMRYLSGN-RM----------------PYD------Y
  488 YRAGAKYVDVNWF-----DPLIKRARLELSA-ED----------------DLD--FVPPW
  489 YQHGASYVDATYF-----DPYVKRARLLHAG-EQ----------------TLD--ELPAL
  490 YEHGAKYVELNIE-----DADILKTRLKSSP-ED----------------LLE--FIPDF
  491 YEYGAKYVELNIE-----DTDILKTRLKSSP-ED----------------LLE--FIPDF
  492 YEYGAKYVELSIE-----DTEILKSRLQSTP-EN----------------LIE--FIPDF
  493 ------------------------------------------------------------
  494 YEYGAKYVELSIE-----DTEILKSRLQSTS-EN----------------LLE--FIPDF
  495 YEYGAKYVKLNIK-----DINILKSRLKFSQ-EK----------------NLE--FIPNA
  496 YEYGAKYVKLNIK-----DIDILKSRLKFSQ-EK----------------SLE--FIPNA
  497 YEHGAKYVKLNIK-----DIDILKSRLKFSQ-EK----------------SLE--FVPNF
  498 YEHGAKYVKLNIK-----DIDILKSRLKFSQ-EE----------------SLK--FIPNA
  499 YEHGAKYVKLNIK-----DIDILKSRLKFSQ-EE----------------SLK--FIPNA
  500 YEHGAKYVKLNIK-----DIDILKSRLKFSQ-EE----------------NLE--FIPNA
  501 YEHGAKYVKLNIK-----DIDILKSRLKFSQ-KE----------------SLE--FLPNA
  502 YRAGAKYVKIDVL-----DAALNRSRIEHGR-AE----------------DLT--YLPAY
  503 YRAGALHTQIFLD-----DLDILSERLKYQD-TD----------------QLR--ENPAF
  504 YRHGATYVQVILD-----DLDVLSSRLQAQN-EE----------------QLT--FNPAY
  505 YELGAGLVEFLLE-----DLDILSSRLSAQD-DA----------------EVQ--KYLPW
  506 QQLGVTNITYQFT-----QSYDSLLKNYHGH-FT----------------TYD--NDLRE
  507 KQLKGMEVIYQFT-----DDYDQLLEKYKNN-YQ----------------IYD--SYLSE
  508 VEAGAYPVFINIG-----DESITEAFYKYAP-QE----------------VLS--HVSIL
  509 VEAGAYPVFINIG-----DESITEAFYKYAP-QE----------------VLS--HVSIL
  510 VEAGAYPVFVNIG-----DESITEAFYKYAS-PD----------------VLS--HVSIL
  511 VSRGGYPVMVNLS-----DESISEVFYRYAT-KD----------------VLE--HISGI
  512 VSRGSYPVMINLS-----DESISEVFYRYAT-KD----------------VLE--HISSI
  513 VEKEAYPLLIRLD-----EESITEAFYKYAP-QN----------------VLT--HVSII
  514 VSRGGYPLLVSLR-----DEVLDEIFYRYAK-DN----------------VLD--HISPV
  515 ------------------------------------------------------------
  516 VSRGAYPIYI-MT-----DEVFSEIFYRYAP-KE----------------LLE--YVSPI
  517 LSRGAYPLL-NLR-----DEYVAEAMYRLAP-EE----------------LLD--YISPI
  518 ------------------------------------------------------------
  519 LKKGGHPLV-ITK-----FAEQEELFYKYAS-EE----------------QLK--YKSPF
  520 IKAGGHPLV-ISN-----FEGQEEIFYKFAS-EE----------------QLT--YQSPF
  521 LKMGCYPIV-RMS-----FAEQLYSFYKYAE-KE----------------QLE--FIPDA
  522 LKIGAYPIV-KMS-----FPEQMYYFYKYAE-KE----------------QLD--FIPEV
  523 LEMGAHPVL-RMM-----ISEQQSVFYKYAT-EK----------------QLE--FIPPS
  524 LEIGAYPVL-RLA-----FSGQQSVFYKHAG-KD----------------QLE--FIPHS
  525 LAAGGHPLM-QVS-----KNEFLEYLLKYGS-DE----------------QIS--YVHFP
  526 LAAGGHPLM-QVS-----KNEFLEYLLRYGS-DG----------------QIS--YVHFP
  527 LAAGGHPLM-QVS-----KNEFLEYLLRYGS-DE----------------QIS--YVHFP
  528 LAAGGHPLM-QVS-----KNEFLEYLLRYGS-DE----------------QIS--YVHFP
  529 LAAGGHPLM-QVS-----KNEFLEYLLRYGS-DE----------------QIS--YVHFP
  530 LAAGGHPIV--MP-----RGDYDDLLFRHGT-EV----------------QLE--FIHEP
  531 LERGGHPHL-LLS-----LPDQEEIFYTAASRDE----------------QLD--FIPAL
  532 --------------------------------DE----------------QLD--FIPTF
  533 ------------Q-----LEELDEIHLREAN-DE----------------QLS--WLSPV
  534 LLAGGHPVA-HTV-----MPGLSRILLNHGN-DK----------------QLQ--WISPY
  535 LQVGAFPQV-LAQ-----LEGLSEIYLKEAS-EE----------------QLR--VLTPL
  536 LRVGAFPQV-LAQ-----LEGLGEIYLKEAS-EE----------------QLR--VLTPL
  537 LLAGANPYL-AMT-----LEETDELLLRHGS-DA----------------QIG--YVSPM
  538 LLAGAHPYL-ALT-----LEETEELLFRYGS-EA----------------QIR--FVSPL
  539 LERGAHPVV-QVA-----LPGLAEIMFRVAN-DQ----------------QLT--FVSPD
  540 ------------------------------------------------------------
  541 LRLGAFPIL-DVH-----LPEAQEILLREGN-DA----------------QLQ--AISPL
  542 IRAGAHVMT-RIT-----IDGLAEIRFRESS-DE----------------QLR--FVLEP
  543 LERGAYPLV-LLE-----YPEQGRHFYEKA--GA----------------WLE--QVPPI
  544 LQRGAYPFV-KLS-----YPGQDADFFQGA--GA----------------WLE--RVPPV
  545 LRRGAYPLI-RLS-----YPGEERDFLLFG--GR----------------WLE--EVPEA
  546 ------------------------------------------------------------
  547 LKRGAYPVF-RIG-----YPGEGRDFLLYG--GA----------------WLE--RIPEV
  548 LQCGAYPIV-QLF-----PAAVSRPFFMLG--EA----------------WLD--RPPKP
  549 LAREAWPLL-RAT-----LPGIDEDFYAHAR-DA----------------QLD--GFGSL
  550 LARGAYPLL-RMA-----YPGEDAEFLERA--GA----------------WLE--RVPEA
  551 LRRGARPVV-RLD-----YPGQDDDFAELAS-DA----------------VLD--SVHPA
  552 LSRGARPVV-RVD-----YPGQDDDFAELAS-DA----------------VLD--AVHAA
  553 LRAGARPAV-RLS-----YPGQDEDFAALAA-DA----------------VLD--EVPQG
  554 LRRGARPVL-NLE-----YPGQLDDFAEFAA-DD----------------VLD--QVHDA
  555 LTRGARPVL-RLE-----YPEQADDFVRLAS-DE----------------VLD--AVHAA
  556 LARGGVPHL-RVS-----YPELTEDLLACAP-EA----------------FFT--AEPTL
  557 LEAGAIPFV-HAS-----LPGLQERFFEHAR-EL----------------HYR--KTPPM
  558 IDRGGHPLL-RLS-----LPGLEEYRLLHAS-ET----------------QLS--RYPMT
  559 VLRGADPIV-RLD-----LPGLSEFYLQNAT-EA----------------QLA--SIPPV
  560 LHAGALVIP-KIV-----DPVFEEIMLKEGT-PE----------------QLQ--FVPST
  561 IQKGVVVDVVMS------PSAFKETLFAYAS-DE----------------LLS--TPSPV
  562 ADRGANPLVVQNRL----GERFRRAYLRNR--D-----------------EFE---TPSH
  563 ADRGANPLVVQDRL----GERFRRAYLRNR--D-----------------EFE---TPSH
  564 ADRGANPLTVQDRL----GARFRRAYLRNH--DG----------------DFE---TPAH
  565 GDQGANPVTTTQRT----GARQRRAYLRSS--DG----------------EFE---TPEH
  566 GDQGANPVTVSQRT----GERQRRAFLRAG--DD----------------EYE---TPEH
  567 GEKGANPVTTSQRT----GKREQRAFLRAS--ESEARSASDKASGEAASPEFE---TPEH
  568 GDRGANPVSLNA------DERAKRAFLRAS--EG-----------------FE---TPSH
  569 GDRGATPVYLAS------DSRAQRAYLKAT--DD----------------DFE---TPTH
  570 ------------------------------------------------------------
  571 GDRGAHPVSMRTNR----SGRAIRSYLQAA--DA-------------ADVDFE---TPAH
  572 GERGAFPLVTAGR-----RDRKRAAFLRAIDPD-----------------DLE---TPEH
  573 AERGANPVYMNN------SSRASRAFLRNH--DG----------------EFE---TPDH
  574 ANRGAHPVSLQN------DSRATRAFLQNYTDTD----------------DFE---TPSH
  575 GDRGANVVAMDA------NPRFTRAFLRAG--DD----------------DYE---TPEH
  576 GDRGANPVYLNY------SKRAQRAFKRSS--D-----------------DFT---EPSH
  577 GQKGANPLFLTY------SERAERAFLRNS--D-----------------EFE---TPDH
  578 GEVGANPVMLARGDRGIGTDRAARAYLQAI--DA---------------EDLS---TPEH
  579 GEVGANPMMVARGDRGIGTDRAARAYLRAA--DE---------------DDLT---APEH
  580 GDRGANPMTLYS------SGEASRAHLKAH--DG----------------DFS---LPEH
  581 GERGANLLSVYR------SDEIQRAYLRAH--DD----------------DFD--ADPEF
  582 GDRGANLVNVYR------SDEIQRAYLQAH--DD----------------DFD--DDPEY
  583 GERGANLLATYG------SDEMTRAYLRAH--DG----------------DFD--ADPEF
  584 GDRGANLLSTYQ------SDELTRAYLQAH--DG----------------SFT--ENPDY
  585 GDRGANLLSTYQ------SDELTRAYLGAH--NG----------------SFT--ENPEY
  586 GERGANLVTTYA------SGEIDRAYQLGH--EG----------------DFD--ADPAH
  587 GERGANLQTSYA------SSEVGRAYALAH--DG----------------DFE--EDPDH
  588 GERGANLLSTYS------SGEITRAYLRAH--EG----------------EFD--EDPAH
  589 GERGANLLATYS------SGEITRAYLQAH--DD----------------AFD--ETPAH
  590 GERGANLLATYG------SGEITRAYLRAH--DG----------------DFD--ENPAH
  591 GERGANLLATYS------SGEVTRAYLRAH--DD----------------EFD--ENPSH
  592 GERGANLLATYS------SGEITRAYLRAH--DG----------------EFD--ENPDH
  593 GERGANVVTTYA------SDEVLRAYLRAH--DA----------------EFD---FGAH
  594 GERGANVVTTYA------SEEVQRAYLRAH--DG----------------DFE---LPEH
  595 GKRNANLLTVYN------SGEVERAYLRAH--DG----------------EFD--ENPAP
  596 GERGASLVMTYN------SAEVSRAYLRGH--ET----------------DFE--PAPAH
  597 VKVGAYPQI-VFR-----SEKLNRILTKFGS-DE----------------QIA--RIPEI
  598 IKAGAYPQI-QFG-----SERLRHLLLKYGN-EK----------------QIS--WIPEI
  599 ----------------------------------------------------------PL
  600 SRAGGHSF-VNLR-----ESSISRQLLLAGT-EE----------------QFR--LEAEM
  601 YRAGGFPF-YQVN-----RDALLRAQLLETT-EE----------------HME--LLARF
  602 TKRGGRPF-VELS-----DRSVLRTMLTHAT-KE----------------QIE--LWAKH
  603 SKGGGRPF-VQLT-----DRTVQRAMLKNAN-KE----------------QLE--LWAEL
  604 YARGGVPY-VELI-----DPSVRAAVLKGAT-QE----------------QIE--HWTQM
  605 QAVGAFPF-LEFR-----DAAVTRKLIMNGT-EE----------------QFK--RMAEI
  606 FAVGALPL-VTLK-----DQEVMRALYQGTS-EE----------------HMA--LMAKY
  607 CRVGGVPF-VTIK-----DNSVNRSLLINAS-EE----------------QLK--MMAKY
  608 YLAGGIPF-TSIK-----NNSVERAILMGAS-QE----------------QME--TMAEY
  609 YQAGGMPF-VSVK-----DNAVERTILLGAT-EE----------------QMK--SLARY
  610 YKVGAIPY-LTIK-----NPELERVLLEQCT-EE----------------QMK--DMARY
  611 YAAGALPF-VTLK-----NNTLQRALLRGAT-AE----------------QLK--LIGQW
  612 YRVGGRPF-VSLA-----MQEIQREILMNLS-EE----------------AAA--MMARY
  613 YEAGGVPY-ISIT-----NHTLQREILKGLS-VE----------------QAQ--NMARW
  614 YRAGGLPF-VSTI-----NHTLQRELLKEFS-VE----------------QAQ--AMTRW
  615 YEAGGHPF-LSVN-----NHTLLRELLKGMT-EE----------------QAQ--AMARW
  616 YKIGALPF-VTIK-----EPKFNRELLLGAS-EE----------------QIE--LVAKY
  617 YEAGGNPF-VQLI-----DQSVQRELLMGAN-ET----------------QLG--IMREA
  618 YKAGGSPY-VQLI-----DPAVSREIAMNCN-EE----------------QLK--TMAQH
  619 YEAGGYPF-VLLK-----DYQVDRSLLLGAQ-EE----------------QLE--LIAHV
  620 YNVGALPF-VLLK-----DHQVDRSLLLGAS-EE----------------QLE--MMASF
  621 YAAGGFPF-VLLK-----DQQVDRALLLGAQ-DE----------------QFD--MMADF
  622 YAVGAHPF-VSLK-----DHQVDRALLLGAQ-EE----------------QFN--MMAEF
  623 YKAGGYPF-VLLK-----DHSVDRALLNGAQ-EE----------------QFN--MMADF
  624 YEAGGYPF-VSLK-----DHSVDRSLLMGAQ-EE----------------QYE--MMAEF
  625 YAAGGFPF-VSLK-----DHQVDRSLLMGAT-EE----------------HFE--QIAAY
  626 YAAGGFPF-VSLK-----DHQVDRSLLMGAT-EE----------------HFE--QIAAY
  627 YAAGGFPF-VSLK-----DHQVDRSLLMGAT-EE----------------HFE--QIAAY
  628 YAAGGFPF-VSLK-----DHQVDRSLLMGAT-EE----------------HFE--QIAAY
  629 YAAGGFPF-VSLK-----DHAVDRSLLMGAT-EE----------------HFE--QIAAY
  630 YKAGSFPF-VSLK-----EPQIDRALMLGAD-SA----------------QYE--KIAEF
  631 YKAGGFPF-VSLK-----EPQIDRALMLGAN-SQ----------------QYE--KIAEF
  632 YKAGGFPF-VSLK-----EPQIDRAMMLGAD-SA----------------QYE--KIAEF
  633 YKAGGFPF-VSLK-----EPQIDRAMMLGAD-KA----------------QYE--KIAEF
  634 YKAGGFPF-VSLK-----EPQIDRAMMLGAD-SS----------------QYA--KIAEF
  635 YEAGGLPF-VLLK-----DNRVLRKLYRNAS-EE----------------QLQ--LMADI
  636 YEAGGHPF-VLLK-----ESRILRKLYTGAS-RE----------------QLE--LMADI
  637 YKAGAHPF-VSLK-----EPAVNRALLMGAT-KE----------------QQD--MQATF
  638 YQAGGLPF-VSLK-----EHEVNRSLLIGAT-SE----------------QQQ--LTAQF
  639 YEAGGIPF-PHFT-----DAQVEREMLLHCT-KE----------------QLQ--LMAEV
  640 YSKGAKPF-LWLK-----HPTLLRSLLLNAT-EE----------------QIE--IIAQN
  641 YSKGAKPF-LWLK-----HPTLLRSLLLNAT-EE----------------QIE--IIAQN
  642 YLKGAKPF-LWLK-----HPTLLRTLLLSAT-EE----------------QIE--MIAQN
  643 YLKGAKPF-LWLK-----HPTLLRTLLLSAT-EE----------------QIE--MIAQN
  644 YSKGAKPF-LWIK-----HPTLLRTLLLNAT-EQ----------------QIE--MIAQN
  645 YSKGAKPF-LWLK-----HPTLLRTLLLNAT-EQ----------------QIE--MIAQN
  646 YQKGAMPF-LWIK-----NQSLLRDLLLNAT-ED----------------QIK--IIAEN
  647 YKVGAKPF-VLLK-----NQEILREILLEAD-EE----------------VIK--INREM
  648 YKVGASPF-VWNH-----DPHILRELLKQCN-EE----------------QMK--IWAKS
  649 YKAGASPF-VWNH-----DPYIMRELLKQCN-EE----------------QMK--IWAKS
  650 YDAGALPF-VSIK-----DKTVERELLLHAT-KE----------------QLR--VRAEI
  651 YKAGGFPY-LKLT-----DSSINREILMGVS-KE----------------QLE--FQNDY
  652 AKVGGNAF-IHNY-----NSRVRREVIRSAS-EE----------------QMK--LSADL
  653 RDRGAIPF-VNLN-----NSRISRELVSGIE-DG----------------QYE--TQAEW
  654 RARGAHPL-VQVH-----HARVTRELNLHAE-EA----------------QFA--PHAEV
  655 REIGAIPY-VNLN-----HARVNRELSLETT-EE----------------SLR--IQSAI
  656 REVGAVPF-VQIH-----SSRVSREMAIGAQ-EE----------------QLD--VASHI
  657 RAVGATPI-VEVR-----HTRITREVLKDTN-DK----------------HAA--LVRDL
  658 REAGAIPL-VQLR-----NNQILKEWVQTAD-ES----------------TLE--VAAQI
  659 YAKGAYPH-LRFV-----RPKVQREWLKGLT-EE----------------QLA--QTVQL
  660 YDLGAYPF-VRII-----DPSIQRELMLGAS-AE----------------RAT--HLAKW
  661 YAVGGHPI-VNMT-----SERVQRALAAEAS-VE----------------SIA--SLAET
  662 YEAGGNPV-VNVW-----SERIERAMVEGAT-ED----------------SLK--VWADV
  663 RNAGAIPF-LRLN-----QSRLNREMLSGAT-EE----------------QYG--IIGRH
  664 AQRGARAY-VELR-----DNRVIRDLTLHGD-DE----------------FFR--LWGRW
  665 FQAGGQVF-VEQT-----DYRINRKMMLSGT-KE----------------QFE--SDAKL
  666 LERGASYVEYGFS-----VPEIDRTFYNLAN-QQ----------------QLA--HFPQH
  667 LQRGAEYVEYSFS-----VPEIDRQLYNLAS-KK----------------QLE--VFPQH
  668 LERGAKYVEYDFT-----IPDINRYFYNKAS-KE----------------QIS--YFPQH
  669 LEKGAKYVEYEFN-----VPDINRYFYNNAT-DE----------------QLA--YFPEH
  670 LARGAKYVEYSFH-----IPEIDRHFYNTAT-KS----------------QLS--FFPQH
  671 LERGAKYVEYEFT-----IPDINRYFYNLAS-AD----------------QLS--YFPQH
  672 LERGAKYVEYEFT-----IPDINRYFYNLAS-AE----------------QLS--YFPQH
  673 ------------------------------------------------------------
  674 LERGWHPVPRMGL-----SPQMEKSLFTVGG-DQ----------------QLE--FIAPG
  675 ------------------------------------------------------------
  676 ------------------------------------------------------------
  677 ------------------------------------------------------------
  678 ------------------------------------------------------------
  679 LERGISPVPRLAL-----TPAMESAFYGKAD-EA----------------QLV--FQAPG
  680 IEKGLNPVARQNM-----TTAMDLSFYGKGS-QD----------------QLT--AVPAG
  681 MDKGINPIPRQNL-----SAPMEVSFYGKGN-DD----------------QLT--AVASG
  682 IAEGLNPVPRMTL-----TPAMEKSFYGDGN-DN----------------QLE--YIAPG
  683 LAQGLNPVLRINP-----PSTLEKGYFSLAW-QE----------------QLS--FVIPG
  684 LDMRLNPVVRLQP-----TAGMERSFYDLSG-QK----------------QLT--FVPPG
  685 ------------------------------------------------------------
  686 LAAGRQVVLRAGQ-----TAVMEETFYRCAD-AE----------------QLV--FLAPG
  687 LEQGMNPILRMSY-----TPTMERQFYELSS-NK----------------QLV--FIPPG
  688 IDRGMNALQRLSM-----TSFMEHHFYSRAK-AK----------------QLL--FIPPG
  689 HDMGMIPVPRMQP-----TPRMEHDLYAKAN-NK----------------RLT--TLIPG
  690 ------------------------------------------------------------
  691 HERGQIPVPRMAH-----TPRMEHDFYTLAN-NK----------------RLT--TLIPG
  692 HDEGMIPVPRMLP-----TPRMERDLYTKAN-NK----------------RLT--TLIPG
  693 LKAGAHPLVFFTP-----DD-MAREFYELAN-EE----------------QLS--FFAEK
  694 KELGAEAIYVEIL-----------------------------------------------
  695 ERLGLNYQAFVLE-------------------------------------DLA-------

              9         10         11        12        13         
      A45678A9012A345678901A2345678901234567890123456789012A345678
                                                                  
                                                                  
    1 -RADSM-NSYA-ENGAAFIAI-TAENPNAFKGVDREKQMAAAKANDKAMEPYY-KRMVSS
    2 -RADSM-NSYA-ENGAAFIAI-TAENPNAFKGVDREKQMAAAKANDKAMEPYY-KRMVSS
    3 -LAESR-NYYA-AQKAAVISI-VGNDPEAYKGVDSEKLKANSKASAKAFEPYY-KRMMNS
    4 -QKARM-DSYV-DDQVAVISI-YADDPDVMAGVDVDRVKAASNAAQAAAKKYH-EAVIND
    5 -FVAKQ-NDAV-EKGSALISV-YADDPDLLKDVDPEKIKTASAAIQSATEAYH-MAMMNN
    6 -QKEFY-LSYV-HQGAAFLSI-AASDPELMKDVNPKRITKAQKASNIALKDYR-DRLMSN
    7 -QKEFY-LSYV-HQGAAFLNI-AASDPELMKDVNPERLTKAQKASNSALKDYR-HRLMSN
    8 -QKEFY-LSYV-HQGAAFLSI-AASDPELMKDVNPLRITKAQKASNTALKDYR-ERLMSN
    9 -QRDFY-LTYV-RQGAAFLTI-SASDPELMRNVKPERIMNAQKASSTALKEYR-DRLMSN
   10 -QKDMY-MGYL-QQGAAFLSI-SANDPELMKDVDPARLMKAQKTGSNALKEYR-EHLMSN
   11 -QKTFF-VDYA-RQGAAFLSI-AASDPELMKEVDPERMVRAQRAHSIALKEHR-ERLMSN
   12 -QKTFF-VDYA-RQGAAFLSI-AASDPELMKEVDPERMVRAQRAQSIALKEHR-ERLMSN
   13 -QKAFY-LDYS-RQGAAFLSI-SASDPELMKGVNPGRIVRAQRASSTALKEHR-DRLMSN
   14 -QREFY-LSYA-RRGAAFVSI-AASDPELLKDVNPQRVAKAQKASNIALEEYR-EKLMSN
   15 -QKDLF-VSCA-KKGAAFFSI-AASNPELMKDVNPERIMRSNKAQSAALSEYR-ERLMAD
   16 -KKELY-TSYA-KSGAAFLSI-YAQDPELMKDVNPKRLMRASKAQNIALSEYR-ERIMTD
   17 -AKEFS-LSYS-RKGAAFLSI-SASDPELMKDVDPNRMARQQKVASSALKEYR-ERMMSN
   18 -QKDFY-LYYS-RKGAAFLSI-YASDPELLKEVDQKTIATAQKAKQLALKEHS-ERLMSN
   19 -MKESR-LSYA-KEGACFLSI-SASDPELLKNIDPAKIAAFRKSSSTALKEFS-EMLMSN
   20 -QVESV-MEYM-RKGAAFLSV-YASDPELLKDVEQNKIAKYQRARSRALKEHY-ERIMNN
   21 -QVESV-MEYM-RKGAAFLSV-YASDPELLKDVEQNKIAKYQRARSRALKEYY-DKILNN
   22 -QVESV-MEYM-RKGAAFLSI-YASDPELLKDVEQSKIAKYQRARSRALKEYY-DRIMNN
   23 -QKESL-DYYV-KKGAAFLSV-YASDPDILKEVDKDKVARAEKCKSLALKEFY-ENLMGN
   24 -EVEEL-ESLA-KENAAFLSI-SASNPELLKNVDPQKIATANKTRGKALKKYY-EYIMNS
   25 -EVEEL-ESLA-KENAAFLSI-SASNPELLKNVDPEKIATSNKTRGRALKKYY-EYIMNS
   26 -KADGF-EQMA-SENAAFLSI-TGTDPDLFKDVDPERIAEANKTNLKSTEKFR-KYTLNS
   27 -LALER-EQLI-KEKTGFISI-AAEDPELLSGIDPNKISLQAKTNSTAMKKAS-AAMMSN
   28 -AVLSR-EQLI-KEKTAFISI-SARDPELLSGVDPNKISTLAKTANRAMKDVS-AAMMSN
   29 -RRAFY-EDYA-AQGAAFVSI-AARDPEIFGDIDPEKLKLANQAAGAALMEYR-ERLMNN
   30 -RVKFC-QGYA-EQGAAFVSI-AARDPQIFSDIDPEKLKLANQAAGAALLEYR-ERLMSN
   31 -RRRLY-EDSA-AEGAAFVTI-HASDPEIFSGVEPERLTLAQQAAGAALLEYR-QRLMSN
   32 -RKAFY-DEHA-AQGAAFISI-AASDPDLYSDIDPKRLTEASQTAGKALMDYR-ARLMSN
   33 -RKLFY-DDHA-ARGAAFISI-AASDPDLYSDIDPKRLTEANQAAGKALMDYR-ARLMSN
   34 -RKAFY-DESA-AQGAAFISI-AAEHPDLFSDVDPKRLTEAGQTAGKALQGYR-ARLMSN
   35 -RKAFY-DESA-AQGAAFISI-AAENPDLFSDVDPKRLTEAGQTAGKALQDYR-ARLMSN
   36 -RKLFY-DDHA-ERGAAFISI-SAADPDIFSDVEPKRLTEAGVSAGKALMEYR-TRLMSN
   37 -RKLFY-DDHA-ERGAAFISI-SAADPDIFSDVEPKRLTEAGVSAGKALMEYR-TRLMSN
   38 -RKLFY-DDHA-GRGAAFISI-AASDPDIFSDIAPEKLTAVQLSAGKALADYR-NRLMSN
   39 -RKLFY-DDHA-GRGAAFISI-AASDPDIFSDIAPEKLTAVQLSAGKALADYR-NRLMSN
   40 -EKDKY-DYYV-ENNAAFLSI-SASDPDIFKDVDSDKISAYQKGRRAALEKYH-SACTSN
   41 -EKDKY-NYYV-EQGASFLSI-SASDPDLLKDIDASKIATVQKSRREALKRYY-EACNSN
   42 -ERDKY-DYFV-ENNASFISI-SASDPDLLKGVDSSKISVYQKSRNIALKNYR-DKCSSN
   43 -VSESY-NSYA-REGCAVISI-SASDPDAYKDIPMEKISTFQKHRQLALKEYY-DYSMAN
   44 -EVKKY-EDLV-AQKAAFISI-SAGDPDLLKDIEPNKIAIAQKASGKALTVFR-KAVSSS
   45 -RRHFY-NDYA-LEGAAYLAI-SASDPENLKGVDSGRVVRAQQAGGKALREFN-RLQMCS
   46 -KATGF-EEMA-QGGAAFLSI-SAANPDLLKDADPQRVATMNKYRGQVLEKFK-TYTQSG
   47 -KAKGF-VEMA-KNNVAVLNL-NSPNPTLLKGIDAQRVAMANKASGEAFKEFQ-PYISGG
   48 -RARAH-QELS-DQNAAFLYI-YSPNPELLNGIDAKRIAAAQKAAAAANKQFS-NDKSSA
   49 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVEPSRIATAHKVAGEAMKVYR-DYVQAD
   50 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVEASRIATAHKVAGEAMKVYR-DYVQAD
   51 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVEPTRIATAHKVAGEAMKVYR-DYVQAD
   52 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVDSTRIATAHKVAGEAMKVYR-DYVQAD
   53 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVDSTRIATAHKVAGEAMKVYR-DYVQAD
   54 -KANAR-EELA-KEGAAFMSI-YAENPDLLKGVDSTRIATAHKVAGEAMKVYR-DYVQAD
   55 -KANAR-EELA-KEGAAFMSI-YAENPDLLKGVDSTRIATAHKVAGEAMKVYR-DYVQAD
   56 ------------------MSI-YAENPDLLKGVEPTRIATAHKVAGEAMKVYR-DYVQAD
   57 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVEPKKIATAHKVAGEAMKVYR-DYVQAD
   58 -KANAR-EELA-KEGAAFMSI-YAENPDLLKGVEPKKIATAHKVAGEAMKVYR-DYVQAD
   59 -KANAR-EELA-KEGAAFMSI-YAENPDLLKGVEPKKIATAHKVAGEAMKVYR-DYVQAD
   60 -KAHAR-EELA-KEGAAFMSI-YAENPDLLKGVDAKRIASAHKVAGEAMKVYR-DYVQAD
   61 -KARAR-EELA-KEGAAFMSI-YAENPDLLKGVDATKIATAHKVAGEAMKVYR-DYVQAD
   62 -KAQAR-EELV-KNGGAVLSV-ISSGPDLLKGVDGKRIAAFQKVSGKAMKKFR-EAIQSD
   63 -EAKGR-EELA-KNGAAFISV-VSSNPDLLKGVDSKRIATFQKAAGKALHTYR-QYIQSD
   64 -EAKGR-EELA-KNGAAFISV-VSSNPDLLKGIDSKRIAAFQKAAGKALHTYR-QYIQSD
   65 -EAKGK-EALA-EKGAAFISV-VSSSPDLLKGIESKRIAAFQKAAGKALHTYR-QYIQSD
   66 -EAKGK-EELA-KKGAAFISV-VSSDPDLLKGADGKRIAAFQKAAGKALHTYR-QYIQSD
   67 -EAKGK-EELA-KKGAAFISV-VSSDPDLLKGTDGKRIAAFQKAAGKALHTYR-QYIQSD
   68 -EAKGL-ETLA-KEGAAFISI-VSSSPDLLKGIDSKKISAQQKAAGKAMHTYR-QMIQSD
   69 -EAKGL-ETLA-KEGAAFISI-VSSSPDLLKGIDSKKISAQQKAAGKAMHTYR-QMIQSD
   70 -EAKGL-ETLA-KEGAAFISI-VSSSPDLLKGIDSKKISAQQKAAGKAMHTYR-QMIQSD
   71 -EAQMM-ETIA-KRGGAFITI-LSESPDLLRGIDSKKIAAQQKAAGSALHTYR-QYVQSD
   72 -RAKEM-EDLA-EKGAAFMSI-VSASPDLLKGVKSERIANFQKAAGKALSKYR-RYAQSD
   73 -RAKEV-EDLA-EKGAAFMSI-VSASPDLLKGVKSERISSFQKAAGQALAKYR-KFIQSD
   74 -RAKET-EELA-EIGAAFMSI-VSSSPDLLKGVNPERIANFQKATGKALAQYR-KYIQSD
   75 -RAKET-EELA-EKGAAFMSI-VSSSPDLLKGVDPERISNFQKTAGKALENYR-KYILSD
   76 -KAKEM-ETLA-ENGAAFMSI-VSASPDLLKGVNPERISNFQKAAGKAMDKYR-SYIQSD
   77 -RAKEK-EELA-EQGAAFISV-LSSSPDLLKGVHPDRISRFQKAAGQALAKFR-QYIQSD
   78 -KVQGL-EEMA-ENGAAFLYI-SAANPDLLKGVNLDRISTANKTAGQALHKFR-SYTMSD
   79 -KVQER-EWLA-EEGAAFMSI-VSQSPDLLSGIDSKRIASFQKASGTALNKYR-QYVQSD
   80 -KVQER-EQLA-EQGAAFISI-MSQSPDLLSGIESSRIAASQKATGQALSKYR-QYVQSD
   81 -KRVER-EELA-DKGAAFMSI-VSQDPDLLNGIEPNRIRDNQKASSTALSKFR-QAMQAD
   82 -KVQER-EWLA-ENGAAFLSI-SSQNPDLLKGIERDRIMAFQKASGQALANYY-QLLQSD
   83 -KVQER-EWLA-ENGAAFLSI-SSQNPDLLKGIERDRIMAFQKASGQALANYY-QMLQSD
   84 -KVQER-EWLA-EHGAAFLSI-SSQNPDLLKGIERDRIMAFQKASGQALANYY-QWLQAD
   85 -EALKR-NTFV-DKRAAFIAI-VSSNPDLLKGIDPKRIGSFQKASGQALDHYR-KAVQSD
   86 -EVAKR-DAFL-DKGAAFISI-SSPNPDLLKDIDPKRIGNYQKTAGKALERFR-RYMQSN
   87 -ETAKR-NSFV-ERNAVFISI-VSSSPDLLSGIDSQRIANFQKAAGQGLQAFR-RAVQSD
   88 -ETQKR-DAFI-NRGAAFVAV-ISSSPDLLKGIDPNRIGSFQKASGAGLKNYR-RAIQSD
   89 -YAGEM-TELV-ENGAAVLHV-LAENPDLLSGIDSERIGNFYKARGEALKQYR-AYQQSD
   90 -YAGEM-TELV-ENGAAVLHV-LAENPDLLSGIDSERIGNFYKARGEALKQYR-AYQQSD
   91 -YAGEM-TELV-ENGAAILHV-LAENPDLLSGIDSERIGNFYKARGEALKQYR-AYQQSD
   92 -YAGEL-TELV-ENGAAILHV-LSENPDLLSGIDPQRIANFYKTRGEAMKKYR-AYQQAD
   93 -YAAEM-TEEV-ENGAAVLHI-IAENPDLLQGIPSSRITAAQRVRSHELRQYR-ELQMAD
   94 -YAAEM-TEEV-ENGAAVLHV-IAENPDLLKGIPSSRITAAQRVRSHELRQYR-EYQMAD
   95 -YAAEM-TEEV-EHGAAVLHV-IADNPDLLKGIPSSRITAAQRVRSHELHQYR-EYQMAD
   96 -YAGEM-LEYV-ENGAAVLHV-ISSDPDLLKGVSTQRLTNHQKAYGKAMSKYR-EMQMSD
   97 -YAGEM-LELA-ENGAAVVSI-TSSDPDLLKGVPQSRIMNHQKTYGKAMHQFR-QYMQSD
   98 -YAEEV-TELA-EQGAAFLTI-LSSNPDLLKGVDPERISNYQRTYGAAMSKYR-QYQQAD
   99 -YAEEV-TELA-EQGAAFLTI-LSSNPDLLKGVDPERISNYQRTYGAAMSKYR-QYQQAD
  100 -YVEEV-TELA-EQGAAFLTI-LSSNPDLLKGVDPERISNYQRTYGAAMSKYR-QYQQAD
  101 -YAEEV-TELA-EQGAAFLTV-LSSNPDLLSGIDPERISNHQRTYGAAMSKYR-QYQQAD
  102 -RAEML-EKAF-GEGAAMLAI-TSVNPDLLKGVDASKIANLQKAAGEATKAYR-NMVMAD
  103 -LAKGY-EELA-ESGAAFLSI-TGSNPDLLKDADPERVSNAAKASGKAMAGFR-SYVMAD
  104 -IAKGF-EELA-ENGAAFLSI-TGQDPDLLKDADPERVANLNKAGGKALKTFR-SYIMAD
  105 -QAKAL-EEEA-DNNAAFLSI-TGGNPDLLKDADPDRVARANKAAGMALDTFR-RYIQSD
  106 -KAKGF-EELA-EKGAAFMTI-KSTDPELLKGVDPEKIATANKTQGQLMNTFR-KYIQSD
  107 -KARGF-EEMA-ENGAAYMTI-KATDPDLLSGVDGEKIAAANKASGQAMNTFR-TYIQSD
  108 -RVAEK-TELA-KEGACFISI-TSDDPDILNGVDSNKISTFQKTMGAAMSEFR-ELMQAN
  109 -RVAEK-TELA-KEGACFISI-TSDDPDILNGVDSNKISTFQKTMGAAMSEFR-ELMQAN
  110 -RVAEK-TELA-KEGACFISI-TSDDPDILNGVDSNKISTFQKTMGAAMSEFR-ELMQAN
  111 ------------------------------------------------------------
  112 -RVAEK-TELA-KEGACFISI-TSEDPDLLNGVDSNKIATFQKTMGGAMSEFR-ELMQAN
  113 -------------EGACFISI-TSEDPDLLNGVDSNKIATFQKTMGGAMSEFR-ELMQAN
  114 -RVAEK-TELA-KEGACFISI-TSEDPDLLNGVDSNKIATFQKTMGGAMSEFR-ELMQAN
  115 -RVAEK-TELA-KEGACFISI-TSEDPDLLNGVDSNKIATFQKTMGGAMSEFR-ELMQAN
  116 -RVAEK-TELA-KEGACFISI-TSEDPDLLNGVDSNKIATFQKTMGGAMSEFR-ELMQAN
  117 -RAAKL-TELA-KEGACFISI-TSEDPDLLKGVDGAKIAANQRANGDALAEYR-ELMMSN
  118 -RVEER-TELA-KENACFISI-VSEDPDLLKGVSGEKIAANQKAMGQALTEFR-ELTMSN
  119 -LKARF-EQLA-EEKTAFLSI-VSDDPDALNGVESSRISDANRAAGQALAKWR-QYVMSD
  120 -LKARF-DQLA-EEKTAFLSV-VSEDPDLLNGVESSRIARANKAAGVALANWR-KFVMSD
  121 -RARAM-EELA-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALANYR-SAIMAD
  122 -RARAM-EELA-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALANYR-SAIMAD
  123 -RARAM-EELA-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALANYR-SAIMAD
  124 -RARAM-EELA-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALANYR-SAIMAD
  125 -RARAM-EELA-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALANYR-SAIMAD
  126 -RARAM-EELA-EQGAAFLSI-HAPNPDLLKDVDPKRIATANKTAAQALANYR-SAIMAD
  127 -RAKAM-EELV-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALINFQ-NAMMTD
  128 -RAKAM-EELV-EQGAAFLSI-YAPNPDLLKDVDPKRIATANKTAAQALINFQ-NAMMTD
  129 -RAKGM-EQLA-EEGAAFLSI-YSPNPDLLKDIDPKRVATANKTASKALSNYR-SALMAD
  130 -RAKGM-EQLA-EEGAAFLSI-YSPNPDLLKDIDPKRVATANKTASKALSNYR-SALMAD
  131 -RAKGM-EQLA-EEGAAFLSI-YSPNPDLLKDIDPKRIATANKTASQALRNYR-SALMAD
  132 -LAKGR-EEVA-EKGGAFLSI-YAPNPDLLKDIDPARVAAATKAASMALQHYR-SRLMAD
  133 -KAQGL-QELA-ENDAAFIQF-YGPNPDLLKDVDPERVSTANKTASTALKGYR-SQLMAH
  134 -KAEGL-EEMV-ADGYSLLSI-YGPNPDLLKDVDSERVAKANKASAQALTKYR-DYIMND
  135 -RVKLY-ESYA-EDGAAVLSI-RSTNPDLLKDIDSSRVAMANKASAQAMKNFR-QYTMND
  136 -KVKLH-DMYA-EDGAAVLSI-RSTNPDLLKDIDPTKVAMANKAAAQAMTNFR-KYTMND
  137 -KVKLH-DSFA-EDGAAVVNI-RATDPDLLKDIDPSKVAKANKAAAQAMVNFR-KYTMND
  138 -QQQKF-TYFA-EQGAAILSI-RSTDPDLLKGIDAGKVAAANKARSEAMSTFR-NYTMND
  139 -KADGF-RQLA-EEGAAFLQV-HSPAPDLLKQAKPERIAAASKAYGTAMLEYR-RMLQAG
  140 -RAQAM-NELA-EQGGAYLFI-KSDDPELLKDINPKRLSDYSRVSSAALATFR-KYMSSK
  141 -SAGEK-LEMA-EKGAASITI-GSADPDLLSGVPQEKIRNADRTARKANEKYR-QMSQAF
  142 -VVRMR-DELI-ERKGALLWI-EAADPDKLTGISADRLATHQKVSGAALKNYR-NAVMKD
  143 -VVQMR-DELI-ERKGALLWI-DAADPDKLTGISADRLATHQKVSGAALKNYR-NAVMKD
  144 -VVKMR-DELI-ERKGALLWI-DAADPDKLTGIPADRLATHQKVSGAALKNYR-NAVMKD
  145 -IVKMN-DELI-ERKGALLMI-DATDPDKFTGISSERLATYQKVAGAALRNNR-NAVMKD
  146 -IVKMN-DELI-ERKGALLMI-DATDPDKFTGISSERLATYQKVAGAALSNNR-NAVMKD
  147 -IVKMN-DELI-ECKGALLMI-DATDPDKFTGISSNRLATYQKVAGAALSNNR-NAVMKD
  148 -IVKMN-DELI-ECKGALLMI-DATDPDKFTGISSNRLATYQKVAGAALSNNR-NAVMKD
  149 -IVKMN-DELI-ERKGALLMI-DATDPDKFTGISSDRLATYQKVAGAALRNNR-NAVMKD
  150 -IVKMN-DELI-ERKGALLMI-DATDPDKFTGISSDRLATYQKVAGAALRNNR-NAVMKD
  151 -IVKMN-DELI-ERKGALLMI-DATDPDKFTGISSDRLATYQKVAGAALRNNR-NAVMKD
  152 -VVAQR-EELI-ERKGALLWI-DAENPDLLAGIDSEKIGAQQKAAGTALVNYR-KAVMND
  153 -PVVQR-DEVI-NTGGCFLWI-DAEDPDLLTGIPAKRLADWQKTAGKALERYR-QAVGTD
  154 -MPAMM-EQLA-ENGGALINI-KVPDPELYKGIDSDKVTRATKAAAVAREKFQ-SYVRNK
  155 -TARMM-EQLA-EGNGALLNI-KVPDPELFKGIDPGKISRAGKAASIARQRFQ-GYVRNH
  156 -QADAM-QQLA-EGGGAILRI-KVPDPELFRGIDSVKVSTAVKAAAMANEKYQ-VYVRNN
  157 -QADAM-QQLA-EGGGAILRI-KVPDPELFRGIDSVKVSTAVKAAAVANEKYQ-VYVRNN
  158 -QADAM-QQLA-EGGGAILRI-KVPDPELFRGIDSAKVSTAVKAAAVASEKYQ-DYVRNN
  159 -QADAM-EQLA-AGGGAILRI-KVPDPELFRGIDSVKVSTAVKAAAVANEKYQ-AYVRNN
  160 -KAEMM-EKFA-EEGGATLTI-KVPNPDLYQGIDPQKVSRATKAAATAREGFS-KYTRNH
  161 -KADML-EKLA-EEGGATLTI-KVPNPDLYQGIDPQKVSRATKAAVTAREGFS-QYTRNH
  162 -KAEMM-EKFA-EEGGATLTI-KVPNPDLYQGIDPQKVSRATKAAVTAREGFS-QYTRNH
  163 -KAEMM-EKFA-EEGGATLTI-KVPNPDLYQGIDPQKVSRATKAAATAREGYA-HYTRNA
  164 -TAEQY-VDIA-KEGGAFLSV-YAQNPDLLKDVDPERVANFQKASGKALKEWR-SYTLTD
  165 -ISDQY-LDIA-KEGGAFLTI-YAQDPDLLKNVDPKRIAEYQKVSGQALKEWR-GYTLTN
  166 -QADKY-TQIA-KEGGSFLTV-VAQDPDLLKGVDPQRIANFQKASGKALKEWR-SYTLTD
  167 -QADKY-TQIA-KEGGSFLSI-ISDDPDLLAGVDPDRIARSQKIAGKFLKEWR-SYTLSD
  168 -QSYKY-TQIA-KEGGSFLSI-IANDPDLMKGVDPDRIGRFQKEAGKYLKEWR-SYTLND
  169 -KAKKL-EDLV-KRGAACIDI-RTTGIGIMDGIDPKKAALDQETMWRALNTYY-DYRMSD
  170 -KFAAQ-NAAV-KDNYAVLHI-YGPNPDLLDTIDDARVGAYMRASSNGLKPYM-ESIMKD
  171 -KIDQT-DDWV-AKGASRISV-VSANPDALAGVDSDRVATYQAASGKAMINLR-KATQAN
  172 -KIDQT-DDWV-AKGASRISV-VSANPDALAGVDSDRVATYQAASGKAMINLR-KATQAN
  173 -KIDQT-EDWV-EKGASRISV-VSANPDALAGVDSDRVAAFQAASGKAMMKLR-QATQAN
  174 -KIDQT-DDWI-AKGASRISV-VSSNPDALAGVDAQRVAAFQAANGKALVNLR-KATQAN
  175 -KIDQT-DDWI-AKGASRISV-VSSNPDALAGVDAQRVAAFQTANGKALVNLR-KATQAN
  176 -KIDQT-DDWI-AKGASRISV-VSSNPDALAGVDAQRVAAFQAANGKALVNLR-KATQAN
  177 ----------------------VSSNPDALAGVDAQRVAAFQAANGKALVNLR-KATQAN
  178 -KIDQT-DDWI-AKGASRISV-VSSNPDALAGVDAQRVAAFQAANGKALVNLR-KATQAN
  179 -KIDQA-DEWL-EKGASRISV-VSADPDAFAGVDSHRVASYQSANGKALMNLR-KATQAN
  180 -KIDQA-DEWI-RKGASRISV-ISSDPGALADVDRKRVAAYQKAAGKGLAKLR-KATQSN
  181 -KVDQA-DDWL-AKGASRISV-VSTDPGAFASVAGDRVATYQAASGKALLNLR-KASQAN
  182 -KIDES-LDQI-AKGASRISV-RSSDPDALSGVDSDKIAAYQSAAGKALSEQR-KATQAN
  183 -KIDES-LDQV-AKGASRISV-RSSDPDALSGVDSDKIAAYQSAAGIALSEQR-KATQAN
  184 -RIEKM-NYLL-KHGASRVGI-ISSDPDNLNGIDGEKIAAAQKANAEALKPMR-EASQAN
  185 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  186 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  187 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  188 -KIAEM-NYLL-GNKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  189 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  190 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  191 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  192 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  193 -KIVEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  194 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  195 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  196 --------------------------------MDADKLSASAKAMGLAMKPMR-IATQSN
  197 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDADKLSASAKAMGLAMKPMR-IATQSN
  198 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDAEKLSASAKAMGIAMKPMR-IATQSN
  199 -KIAEM-NYLL-ENKASRLGV-RSSDPGALNGVDAEKLSASAKAMGIAMKPMR-IATQSN
  200 ------------------------------------------------------------
  201 -KIAEM-NYLL-EHKASRLGV-RSSDPGALNGVDAEKLSASAKAMGIAMKPMR-IATQSN
  202 -KIAEM-NYLL-EHKASRLGV-RSSDPGALNGVDAEKLSASANALGMAMKPMR-IATQSN
  203 -KIAEM-NYLL-DHKASRLGV-RSSDPGALNGVDAEKLSASAKALGMAMKPMR-IATQSN
  204 -KIAEM-NYLL-DHKASRLGV-RSSDPGALNGVDAEKLSASAKALGMAMKPMR-IATQSN
  205 -KIAEM-NYLL-EHKASRLGV-RSSDPGALNGVDAEKLSASAKALGMAMKPMR-IATQSN
  206 -KVAEM-NYLL-EKKASRLGV-RSSDPGALNGVDAEKLSASAKAMGIAMKPMR-IATQSN
  207 -KVAEM-NYLL-EKKASRLGV-RSSDPGALNGVDSEKLSASAKALGLAMKPMR-IATQSN
  208 -KIAEM-NYLL-EHKASRLGV-RSSDPGALNGVEAEKLSASAKALGLAMKPMR-IATQSN
  209 -KVAEM-NYLL-EKKASRLGV-RSSDPGALNGVDAEKLSASAKALGMAMKPMR-IATQSN
  210 -KVAEV-NYLL-EKKASRLGV-RSSDPGALNGVDAEKLSASAKAMGLAMKPMR-IATQSN
  211 -KVAEM-NYLL-EKKASRLGV-RSSDPGALNGVDAEKLSASAKAMGLAMKPMR-IATQSN
  212 -KKAEM-EYLL-AKKASRLGV-RSSDPGALNGVAPERLSAHAKATGVAFKPMQ-VATQSN
  213 -KKAEM-EYLL-DKKASRLGV-RSSDPGALNGVAPERLSAHAKATGVAFKPMQ-VATQSN
  214 -KKAEM-EYLL-AKKASRLGV-RSSDPGALNGVAPERLSAHAKATGVAFKPMQ-VATQSN
  215 -KKAEM-EYLL-EKKASRLGV-RSSDPDAFNGVAPERLSAHAKAIGAAFKPMQ-VATQSN
  216 -KKAEM-EYLL-EKKASRLGV-RSSDPDAFNGVAPERLSAHAKAIGAAFKPMQ-VATQSN
  217 -RITEM-NYLL-ERKASRLVV-LSEDPGAYDGVDPEKLSRNARALSQALNPMR-QASQAN
  218 -KVQEM-HYLL-DHKASRLSI-VSRDPDALNGVDTSRLAKSMKATSVALKPMR-LAGQSN
  219 -KVQEM-HYLL-DHKASRLSI-VSKDPDALNGVDTSRLAKSMKATSVALKPMR-IAGQSN
  220 -KIAETEDHVL-NHKVSRLSI-LSSDPGLLNDVDPHKVAAYQNTAAKAFKAQR-VATQND
  221 -LVEKS-NYFL-EKNASRLFV-RSSDPNAFAGVDSKRLSEATKATAIALEKQR-AASQAN
  222 -LVEKS-NYFL-EKNASRLFV-RSSDPNAFAGVDSERLSEATKATAIALEKQR-AASQAN
  223 -VVEKS-NYLL-GKNTSRLFV-RSSDPNAFSGVDSERLSASTKATAIALEKQR-AASQAN
  224 ------------------------------------------------------------
  225 -VVEKS-HYLL-GKKASRLVV-RSSDPNVFAGVDSDRLSGSTRATSIALEKQR-AATQAN
  226 -VVQRS-RYFL-SKNTSRLVV-RSSDPNAFSGVDSDRLSASTRAISVALEEQR-AATQAN
  227 -IVEKS-NYFL-DKNASRLFV-RSSNPNAFAGVDPERLSSSTKATAIALEKQR-AASQAN
  228 -VVEQS-HYLL-DQKASRLVI-RSANPNVFADVDSDRLAGATRATAIALEKQR-AATQAN
  229 -IVEKS-HYFL-DKKASRLFV-RSSDPNAFSGVDQERLSESTKATAIALEEQR-AATQAN
  230 -TVDKS-LALL-NKKASRLVV-KSSNPNAFATVDPKRLSETTRATAIALEEQS-RAIQAN
  231 -LIDEG-HYFV-EKRAKRISL-VSRDPNALKGIDPNKINASNRAFSNALEEVR-NATQSN
  232 -VVAES-DYYI-EKRAKRLAI-RSTDPNNFKGIDADKIAAANKAKSIAMHNMR-LATQAN
  233 -AVAKA-EYFL-EKRAKRLAL-RSTDPNNLSGLDAQKISASQRALRSAIAHVS-TAIQAN
  234 -TVARQ-EDLILNQKVSRLSI-VSGDPDLLNGIDPSKIDTVQTSRGQKLKVVR-NATMND
  235 -LVKEA-EYIA-DNKAARISV-ISEDPDAFNGLDHNRVSTFQKANGKALNVVR-KATQNN
  236 -LVKEA-EYIA-NNKAARISV-ISEDPDAFNGLDHNRVSTFQKANGKALNIVR-KATQNN
  237 -VSAEA-DYIV-DKHAARISV-ISEDPDAFSGIDPKRIAKNQAAMGKALLNVH-KATQNN
  238 -IVKKG-NYIA-EKKAARISV-MSADPGAYSGIDQKRIAKNQAAMGKALRQVR-KATQNN
  239 -LVDES-QYIV-DKHAARISV-LSEDPAAFAKINPKRVAKNSAAMGKATNAVR-VATQNN
  240 -EKAEG-KWIA-DEKAARISV-ISSDPNALSGVDTKRVAAWNKTCDDALEPVM-DATINH
  241 -VKGQF-DYWV-DHQAKRITV-VSSDPDNLAGIDSNRIAKYQEAFAKAYKRLM-EAISSM
  242 -VKGQF-DYWV-DHQAKRITV-ISSDPDNLAAIDPARIANYQEAFTKAYQRLM-NAISSM
  243 -IKGQF-DYWV-DHNAKRITV-ISADPDNLAGLDPQRIANYQNAFNQAYARLM-DAISSM
  244 -IKGQF-DYWV-DHNAKRITV-ISADPDNLAGLDPQRIANYQNAFNQAYARLM-DAISSM
  245 -IKGQF-DYWV-DHNAKRITV-ISADPDNLAGLDPQRIANYQNAFNQAYARLM-DAISSM
  246 -QKQEY-DYWL-ANNAKRISV-MSSNPDNLKGLDGDRVAAVQKTNGQAMLKVR-QATQAN
  247 -QKQEY-DYWL-ANNAKRISV-MSSDPDNLKGLDGDRVAAAQLANGKAMLKVR-QATQAN
  248 -ATAQV-NDWL-DKAATRIVV-MSADPSSLSGLPAERIAAYQQTQAQIKQPLM-QALQAN
  249 -VSVRA-ESLM-ANQTSRISI-VSSDPDGFSDVPSDRVSLYEQAYQKANVAVR-QATMNN
  250 -VSVRA-ESLM-ANQTSRISI-VSNDSDGFSGVPSDRVSLYEQAYQRANTAVR-QATMNN
  251 -VSVRA-EELM-AKHTTRISL-ISADPDGLGAVDGDRVSAYQQAYQRANQAVR-KATMNN
  252 -TTIRA-KEIA-DKHTARISI-ISEDPDALGDLNQNDVANYSKALAYAKKPVM-DATMNN
  253 ------------------------------------------------------------
  254 -EVLKA-NTLM-DKYASRISL-VSQDPDGLAGVDADRLQTYTKATQKALHRVR-DATMKD
  255 -TVAKA-NELM-DQYASRISL-VSQDPDGLAGVDAERLHTLTKANQKALGRVR-EATMKD
  256 -EVAKA-NELM-DNYASRISL-VSQDPDGLSNVDPIRLDTFTKSKQKALGRVR-EATMKD
  257 -EVAKA-NELM-DNYASRISL-VSQDPDGLSNVDPIRLDTFTKSKQKALGRVR-EATMKD
  258 -QVTKA-NELM-DKYASRISL-ISQDPDGLADVDAERLATLTKANQKALFRVR-EATMKD
  259 -DILKA-NTLM-ANNASRISL-VSQDPDGLAGVDSTRLQTMTKANQKAFTSVR-EATMKD
  260 -TIDKW-QDLIVNQHASRISL-LSDDPDGLAHVDAHKLSTLTQTKQRDLAMVR-NATMRD
  261 -LKVWG-DDLIGRKNATRISI-MSDNPDNLSGIDPQVIANRRQALRPALKTVA-QKTTAD
  262 -ISDKW-RTIA-DERVSRISI-ISDDPNALVDIPAEKISAYQNARTLSQRPIM-EVTTNN
  263 -EKDKW-QFLA-DQRVSRISL-ISDDPNALAEVPSKRIAAYQAAQGLAKRPIM-QVTTNN
  264 -AIDER-NDYL-DNNVVFIHI-LSSSPNLFAGIDAEKLGALTKNAGEAYKHYR-TCIMTD
  265 -AIDER-NDYL-DNNVVFIHI-LSSSPNLFAGIDAEKLGALTKNAGEAYKHYR-TCIMTD
  266 -LVDER-NEYL-DNNVVFIHI-LSSSPNLLSGIDPKKLGTYTKNMGEAFKYYR-SRVMTD
  267 -LVDER-MDYA-NDYAAQLAL-ISSSPENLKDADPKKVSANMKAYGTAFKDYM-KMMQSD
  268 -DVDER-LDYV-ERGAANLAL-IAEDPDLLNGIDGNKLKAFQAQYSKGFKPYM-EASQKN
  269 -DVDER-LDYV-ERGAANLAL-IAEDPDLLNGIDGNKLKAFQAQYSKGFKPYM-EASQKN
  270 -DIDER-LDYV-KRGAANLAL-IAEDPDLLNGIDVNKLKAYQAQYSKGFKPYM-EASQKN
  271 ------------------------------------------------------------
  272 -DIEER-LDYV-NRGAANLAL-IAEDPELLNGIDAQKLKAYQTVYSKGFKPYM-EASQKN
  273 -DIEER-LDYV-NRGAANLAL-IAEDPELLNGIDAQKLKAYQTVYSKGFKPYM-EASQKN
  274 -DVEER-MDYA-RRGAANLAL-ISGDPDLLNGIDAEKLKASQFNYGQAFKGYM-EGSQKN
  275 -DVEAR-MDFV-NRGAANLAI-LTEDPDLLSGIDASKLKAYQLQYSKAYKGYM-EASQKN
  276 -DVEAR-MDFV-KRGAANLAI-LTEDPDLLSGIDASKLKAYQLQYSKAYKGYM-EASQKN
  277 -EVDER-MDYA-NRGAANLAL-LSGDPNLLNGIDPEKLKANQISYSQAFKGYM-EGSQKN
  278 -DVEAR-MDYV-KRGAANLAL-ISEDPDLMDGIDSQKLQAFQQQNARAFKGYM-ESVQKN
  279 -DVEAR-MDYV-KRGAANLAL-ISEDPDLMDGIDSQKLQAFQQQNARAFKGYM-ESVQKN
  280 --------------GAANLAL-ISEDPDLMDGIDSQKLQAFQQQNARAFKGYM-ESVQKN
  281 -DVEAR-MDYV-KRGAANLAL-ISEDPDLMDGIDSQKLQAFQQQNARAFKGYM-ESVQKN
  282 -DVEAR-MDYV-KRGAANLAL-ISEDPDLMNGIDSKKLQAFQQQNSRAFKGYM-ERVQKN
  283 -DVDER-MDYV-QRGAANLAL-LSGDPDLLNGIDSDKLKANQIEYSKAFKGYM-EASQKN
  284 -DVDAR-MDYV-SRGAANLAL-ISEDPYLMEGIDSNKLQAAQQQYSSAYKGYM-EGVQKN
  285 -EVEQR-MDYV-KRGAANLAL-ITKDPDLLSGIDGDKLSVFQRQYSMAYKGYM-EASQKN
  286 -EVEKR-MDYV-KRGAANLAL-ITQDPDLLNGIDSEKLSTYQRQYSTAYKGYM-EASQKN
  287 -DVEAR-MDYM-KRGAANLAL-LTDDPDLLNGIDSEKIAAFQQQYGKAYKDYM-EATQKN
  288 -DVDER-MDYV-ERGAANLAL-ISSDPDLLSGVDSDKKAAFSNAYSKGFKGYM-EASQNN
  289 -DVEER-MDYV-NRGACMLAL-LSEDPDLLNGIDSDKLKAAQRQYAKAFKPYM-IAAQKN
  290 -EYEKY-ETLL-KNDLKQIFI-KAVDPELLKDVDPNKIAKVEQARATKMQPLK-NFRMND
  291 -SYDKL-EWFA-KAGEKKIGI-SAQDPELFKGLDTQKLQRAFKASGEKYQPLR-KYTMND
  292 ------------------------------------------------------------
  293 -IVEKS-KYYF-EKKAGVISV-SCQDPENLKGVDADRVQMRSKVSAEKMKPIQ-KYTMND
  294 ------------------------------------------------------------
  295 -IVEKS-KYYF-EKKAGVISV-SCQDPENLKGVDPDRVQMRSKVSAEKMKPIQ-KYTMND
  296 -TVDQY-TDYI-DSDAVFISV-VGDDPNNLDGLDIAKIKASSIANSKAMKYFS-TSLMSD
  297 -TVDQY-TDYI-DSNAVFISV-VGDDPNKFDGLDIEKIKANSVANSKAMKYFS-TSLMAD
  298 -TVDQY-TDYI-DSDAVFISV-VGNDPNNLDGLDIEKIKASSIANSKAMKYFS-TSLMSD
  299 -LQTQY-EEYR-QDNIALLSL-VGQDPSLLKEIDANKIKSASTARSIALKSFN-EDMMSD
  300 -FIDEQ-NGYI-EKKAKFLSI-TGDDPNLLSDVNPEKVKAAVKAKSIALKSFS-EKMMNS
  301 -VIDEQ-LYLL-DNKAKYVKV-IGSDPNGLKGVDSDKLQKAIMARSKALKEVD-KRMMNS
  302 -LIDKK-KYRV-GNKYKFLSV-ISNDPNSLKGVDPEKLNASMIARSKAFKETS-DLIMAN
  303 -LIEKE-NYFI-NKKAKFLSI-TGGNPELFKGIDSSKIKAANVANGIAFKDFS-EKLMSN
  304 -LIEKE-NYFI-NKKAKYLSI-TGGNPELFKGIDSSKIKAANVANGIAFKDFS-EKLMSN
  305 -KVDKE-NYYM-EKKAKYLSV-TGSDPDAFKGVDAEKLFKSNLANSKALRDFS-AKMMAN
  306 -YIDRY-QESL-EEGTAYLSV-IGDDPDGLAGADSSKLKASMIGRSKALRNYM-KAIMSD
  307 -YIDKY-QVEL-DEGAAFLSI-IGDDPDGLAGVDSEKLKASMVGRSKAMRNYM-KSIMSD
  308 -YVDHY-QETL-ENGAAFLSI-IGDDPDGLAGVDSNKMKASLVGRSKALRNYM-KSIMSD
  309 -KLAKLDYQIA-KKKSNRISI-HAEDPDLLNGLDSEKISEAIRENSKKTKDYV-KYTMND
  310 -KIEKLDYQIA-QKKSNRISI-YAEDPDLLKGLDSEKISEAIRENSKKTKEYV-KYTMND
  311 -LVEKSRYQIA-EKRSNRISI-VSEDPDLLKGLDETKISEAVKARSLKLKDFV-KYTMND
  312 -IIEKNIYQLE-KHRSNRISI-IGDDPDLLKDLDQKKIAEAVRENSLKLKDFV-KYTMND
  313 -IIEKNIYQLE-KHRSNRISI-IGDDPDLLKDLDQKKIAEAVRENSLKLKDFV-KYTMND
  314 -IIEKNIYQLE-KHRSNRISI-IGDDPDLLKDLDQKKIAEAVRENSLKLKDFV-KYTMND
  315 -QVEWV-ERLA-EMGAAYVAM-PASDPALFAGIPRDRVEQAERAVREAFRPFD-NQRTSD
  316 -QVEWV-QRLA-DEGAVYLAL-PATDPDLFAGIDPKQVTAFLNAQAEIFRPFN-DKRTND
  317 -QIDCK-LDYM-KEGACILHI-ISDIPGILKDADAEKISKARLAMAKAGKELQ-SYTMMN
  318 -QIDCK-LDYM-KEGACILHI-ISDIPGILKDADAEKISKARLAMAKAGKELQ-SYTMMN
  319 -QIDCK-LDYM-KEGACILHI-ISDIPGILKDADAEKISKARLAMAKAGKELQ-SYTMMN
  320 -QIDCK-LDYM-KEGACILHI-ISDIPGILKDADAEKISKARLAMAKAGKELQ-SYTMMN
  321 -QIDCK-LDYM-KEGACILHI-ISDIPGILKDVDAAKISKARLAMAKAGKELQ-SYTMMN
  322 -QVHSK-LDYL-KEGACILHI-ISELPGVFKDVDAAKVAKARLAGAKANKEAQ-AYTMMN
  323 -QVHSK-LDYL-KEGACILHI-ISELPGVFKDVDAAKIAKARLAGAKANKEAQ-AYTMMN
  324 -QIASK-LEYF-EEGACILNL-ISRIPGILNGLDVEKVNKHLHAFALKSKKVR-EYTMLS
  325 -LMARE-QEFI-DRGYCILHI-DSSIPGIMKDVDQKKVQQVVTARRKALEKFQ-NYTMAN
  326 -KYDCV-KREH-DLGACYLRI-SSDMPGALKDVDQSKVRAYQMAYSKKMKDLR-KYTMNN
  327 -VHDKN-KYLQ-EQRVCSLRV-ESDCPGGLKDLDQEKISAYSQAFSEKMHDLV-DYTMKN
  328 -LIDEY-DSYL-DEDLCRLSI-YAPSPGLMADVDGDKLAAQAKAQAQALKRMR-EYTMAN
  329 -SIDQY-KYYV-DQNAAFISI-VSPIPNALAGVDSKKMQEVMIESSKMLKFFR-EHTMGN
  330 -EIKAS-EYLL-DKKGAVLSI-TGGDPDALKDVPPERIGIFTKTVNTANKDIM-RRMMSN
  331 -EIKAS-EYLL-DKKGAVLSI-TGADPDALKDVPPDRIGIFTKTANLANKDIM-KRMMTN
  332 -EVEAA-KFFC-DEKGAFLSV-ISSDPDLFKEIPPEIIGKFSKANQMAMKEVS-KEIMSG
  333 -EVEMA-KSFL-DDGAATISL-VGSYADLLSDVPANRIGAATKARQIAFREIM-ERTMMN
  334 -EIEMR-MSFL-EKGAATVSL-VGSYADLLADVPSKRLGMATKARQQAFKDIM-ERTMMN
  335 -MAEGY-TELV-KNGAAVLSV-FVSDPELLKDVDPDKIKRDTITKSNTFKEYK-DYVMNG
  336 -RRDFS-LTYY-RKGAAFLSL-ISADPDLLKGVDKEKLVAFQKASHTALKEYS-DGIMAS
  337 ------------------------------------------------------------
  338 -RSEFN-LDYY-RKGAAFLSL-ISADPYAMKGIDRKKIMAWQKAFHQAVKEYS-DGMMAS
  339 -RRDFS-LYYY-HKKAAFLSL-ISANPYLMDGIDTKKIFAQQKAQNEALKEYI-DGMMAS
  340 -KRDFY-LHYY-HKKAAFINL-ISANLSLLQGISSEKITAWQHARHSALQEYI-SGMMAS
  341 -KRDFY-LHYY-HKKAAFINL-ISANPSLLQGISSEKITAWQHARHNALQEYI-SGMMAS
  342 -IPEFY-KQYI-DDKAAFLSL-ISANPKALEGIPTNRISLQSRNLNKALSFYH-TAIMKS
  343 -IPEFY-KQYI-DDKAAFLSL-ISANPKALEGIPTDRISLQSRNLNKALSFYH-TAIMNS
  344 -IPEFY-KQYI-DDKAAFLSL-ISANPKALEGIPTDRISLQSRNLNKALSFYH-TAIMNS
  345 -IPEFY-KQYI-DDKAAFLSL-ISANPKALAGIPTERISLQSRNLNKALSFYH-TAIMNS
  346 -IPEFY-KQYI-DDKAAFLSL-ISANPKALAGIPTERISLHSRNLNKALSFYH-TAIMNS
  347 -IPEFY-KQYI-DDKAAFLSL-ISANPKALAGIPTERISLHSRNLNKALSFYH-TAIMNS
  348 -IPVYY-EQYV-EEKAAFLSL-ISANPKALAGIPTERISLNSRNLNKVLSFYH-TAIMNS
  349 -IKDMY-NHIL-DSNACILSL-ISANPFAYEGVPSEKIALASRSMGKLTKFYH-EAIMDS
  350 -KVEFL-REAY-KANYHRLAL-IAPNPELLKTVDPRKVSQWQLVYATAMKPVM-KYTMEN
  351 -KIDYM-EAAY-KNNYHRLAI-VADNPELLKNADAKKVSEWNKTRAIASKPIM-KYTMEN
  352 -KVDSL-EDMY-KDNYHHLFI-MAPDPELLKDVDGDLVAQSQKSASVAMAPIM-HYRMTG
  353 -QLRRYLDYAESEGSVCVLHL-IADDPELFAGLDGAKISRVNSANRSFMQPWR-EYTMND
  354 -LQRSYLDYVESEGGACMLSI-SARDPEIYKGLDMEKIDRANQAAMKAQEEWR-SYTMSD
  355 -ELRSYLDYAEDPDGCCTLAI-HAEDPEALAGLDAAKVNRVNLAKRTFMKPWQ-EYTMND
  356 -LYEGM-ARAF-REGAARLAV-SGSDPKALEGLPPEKVGRAQKANARAYKPAL-EAITEF
  357 -LYEGM-ARAF-REGAARLAV-SGSDPKALEGLPPERVGRAQKANARAYKPAL-EAITEF
  358 -LYEGM-AKAF-REGAARLAV-SGNDPKALEGLPPERIGRAQQAQSRAYKPAL-DAITEF
  359 -LYEGM-AKAF-REGAARLAV-SGNDPKALEGLPPERVGRAQQANSRAYKPAL-EAITEF
  360 -LYEGM-AKAF-HEGAARLAV-SGNDPKALEGLPPERVGRAQQAQSRAYRPTL-SAITEF
  361 -LYEGM-AKAF-REGAARLAV-SGNDPRALEGLPPERIGRAQQAQSRAYKPAL-EAITEF
  362 -LYEGV-AKSI-DEGAAMLTV-VGTDPMLLADCDPARIGRAQRAMARAMKPVR-GLISGF
  363 -LYEGV-AKSI-DEGAAMLTV-VGTDPMLLADCDPARIGRAQRAMARAMKPVR-GLISGF
  364 -LYEGM-AEAY-AAGAARLAI-TGQNPALLKGQDPDRISRASKAQSIANRRAL-ELIASF
  365 -LYNGM-AEAF-QAGAARLHI-AGSDPNLLGGQPPEKVARANRARSLAYRRVL-ELITTH
  366 -LFEGM-ATAF-REGAARLAI-VGEDPSLLAGEDSDKVSRANRARSKAYMPAL-ELIAGF
  367 -LYEGM-ANAF-KAGAARLAI-SGENPSLLANEDPARVSRANRARSKAYMPAL-SLIAGF
  368 -LYEGM-ASAY-RSGAARLAI-VGDDPALLAGQDPDKVARANRARSKAYQPAL-ELIATF
  369 -LYEGM-ASAY-RNGAARLAI-VGDDPSLLSGQDPDKVARANRARSRAYQPAL-ELIATF
  370 -LYAGM-ADAY-RSGAARLAI-SGDDPSLLAGQDPSKVARANRSRSQAYVPAL-ELIAGF
  371 -LYAGM-ADAY-RSGAARLAI-SGDDPSLLAGQDPSKVARANRSRSQAYVPAL-ELIAGF
  372 ---------------------------------------------------------AGF
  373 -LYAGM-ADAY-RGGAARLAI-SGDDPSLLAGQDPAKVARANRSRSQAYVPAL-ELIAGF
  374 -LYEGM-AKAF-ASNTARLAV-VGDNPMLLSGEDAAKVARANKANSMAYQPAL-EKIVGF
  375 -LYEGM-AKAF-AANTARLAI-VGDNPMLLSGEDAAKVARANKANSVAYQPAL-EKIVGF
  376 -LYEGM-AKAF-TANTARLAV-VGDNPMLLSGEDAAKVARANKANSMAYQPAL-EKVVGF
  377 -LYEGV-AKAF-SQNTARLAI-VGDNPMLLSGEDPAKVSRASKANSLAYKPAL-EKIAGF
  378 -LYQGM-AKAF-SENTARLAI-VGDNPMLLSGQDPTKVARASKANSKAYQPAL-EKITNF
  379 -LYQGM-AKAF-SENTARLAI-VGDNPMLLSGQDPAKVARASKANSKAYQPAL-EKITNF
  380 -LYQGM-AKAF-SENTARLAI-VGDNPMLLSGQDPAKVARASKANSKAYQPAL-EKITNF
  381 ------------------------------------------------------------
  382 -LYQGM-AKAF-SENTARLAI-VGDNPMLLSGQDPAKVARASKANSKAYQPAL-EKITNF
  383 -LYQGM-AKAF-SENTARLAI-VGDNPMLLSGQDPAKVARASKANSKAYQPAL-EKITNF
  384 -LYEGM-AKAF-SDNTARLAI-VGDNPMLLSGEDPSKVARASKANSMAYQPAL-EKIVNF
  385 -LYEGM-AKAF-SNNTARLAI-VGDNPMLLSGEDASKVARASKANSIAYQPAL-EKIVNF
  386 -LYEGM-AKAF-SNNTARLAI-VGDNPMLLSGEDASKVARASKANSMAYQPAL-EKIVNF
  387 -LYEGM-AKAF-SNNTARLAI-VGDNPMLLSGEDASKVARASKANSMAYQPAL-EKIVNF
  388 -LYEGM-AKAF-SNNAARLAV-RGEDPSLLSAQDPAKVARANKANSMAYQPAL-EKITGF
  389 -LYEGM-AKAF-SNNAARLAV-RGEDPSLLSAQDPAKVARANKANSMAYQPAL-EKITGF
  390 -LYEGM-AKAF-SNNAARLAV-RGEDPSLLSAQDPAKVARANKANSMAYQPAL-EKITGF
  391 -LYEGM-AKAF-SNNAARLAV-RGEDPSLLSAQDPAKVARANKANSMAYQPAL-EKITGF
  392 -LYEGM-AKAF-AGNAARLAV-RGEDPSLLSAQDPSKVARANKANSMAYQPAL-EKITGF
  393 -LYEGM-AKAF-GANTARLAI-VGEDPMLLSEQDPARVSRASKANSIAYKPAL-EKIVGF
  394 -LYEGM-AKAY-ANGAARLAV-AGDNPLLLSEQDAGKVGRANRATSTAYKPAL-EKISNF
  395 -LYEGM-AKAY-ANGAARLAV-AGDNPLLLSEQDAGKVGRANRANSTAYKPAL-EKIANF
  396 -LYEGM-AKAY-ANGAARLAV-SGDNPLLLSEQDAGKVGRANRATSTAYKPAL-EKISNF
  397 -LYEGM-GKAF-ANNTARLAI-SGDNPMLLSGQDPAKVARANRANSAAYKPAL-EKISNF
  398 -LYEGM-ARAY-AGGAARLAI-AGDNPMLLSAQDPTKVARANKANSIAYKPAL-EKISNF
  399 -LYEGM-AKAY-AGGAARLAI-AGDNPMLLSAQDPAKVARANKANSIAYKPAL-EKISNF
  400 -LYQGM-AKAF-AGGAARLAI-AGDNPMLLSSQDPQKVARANRANSIAYKPAL-EKISNF
  401 -LYQGM-AKAF-AGGAARLAI-AGDNPMLLSSEDPQKVARANRANSVAYKPAL-EKISNF
  402 -LYEGM-AKAY-AGGAARLAI-SGDNPMLLASQDPAKVARANKANSIAFKPAL-EPISNF
  403 -LYEGM-AKAY-ANGAARLAV-AGDNPMLLSGQDPAKVARANKANSIAYKPAL-EYISNF
  404 -LYEGM-AKAY-ANGAARLVI-AGDNPMLLAEEDPAKVARANKANSTAYKPAL-EKISNF
  405 -LYEGM-AKAY-ANGAARLAI-AGDNPMLLAEEDPAKVARANKANSTAYKPAL-EKISNF
  406 -LYDGM-AKAY-ANGAARLAI-AGDNPMLLAEQDPAKVARANKANSTAYKPAL-EKISNF
  407 -LYDGM-AKAY-ANGAARLAI-AGDNPMLLAEQDPAKVARANKANSTAYKPAL-EKISNF
  408 -LYEGM-AKAY-SDGAARLAI-AADNPMLLSSQDPAKVSRANRANSKAYQPAL-EKIAGF
  409 -LYQGM-AKAY-SNGAARLAI-AADNPMLLSSQDPAKVSRANRANSKAYQPAL-EKIAGF
  410 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  411 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  412 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  413 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  414 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  415 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  416 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  417 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  418 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  419 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  420 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  421 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSAQDAGKVSRANRANSRAYQPAL-EKIAGF
  422 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  423 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  424 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  425 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  426 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  427 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  428 -LYEGM-AKAY-SGGAARLAI-AADNPMLLSTQDAGKVSRANRANSRAYQPAL-EKIAGF
  429 -LYRGM-REAF-DNNAARLAI-SGDNPMMLSAQDPAKVARVNRATSAAYKPAL-EKISGF
  430 -LYEGM-ARAF-GSNTARLAI-SGDNPMMLAEQDPEKVSRANRANSKAYKPAI-KKITGF
  431 -LYEGM-AKAF-ENGAARLAI-VGDNPLLLSNQDLNKVSRLNKATSIAYQPAL-NKISNF
  432 -LYEGM-AKAF-ENGAARLAI-VGDNPLLLSNQDLNKVSRLNKATSIAYQPAL-NKISNF
  433 -LYEGM-AKAF-ENGAARLAI-VGDNPLLLSNQDWNKVSCLNKATSIAYQPAL-NKISNF
  434 -LYEGM-AKAF-ENGAARLAI-VGDDPLLFSNQDLDKISRLNKATSMAYQPAL-NKISNF
  435 -LYEGI-AKAF-ENGAARLAI-VGDNPSLLSNQDLDKVTRLNKASSMAYKPAL-NKISNF
  436 -LYEGM-AKAF-ENGAARLAI-VGDNPLLLSNQDFDKVARLNKATSLAYQPAL-KKISNF
  437 -LYEGM-AKAF-ENGAARLAI-VGDNPLLLSNQDFDKIARLNKATSLAYQPAL-KKISNF
  438 -LYEGM-AKAF-ENGAARLAI-VGDNPFLFSNQDFDKVARLNKATSMAYQPAL-KKISNF
  439 -LYEGM-AQAF-RNGAARLAI-VGDDPSLLSNQDFNKVARLSKATSIAYQPAL-KEISNF
  440 -LYEGM-AEAF-KRGAARMAI-VGEDPMLLAEQDAAKVSRAGKANSAAYKPAL-EKIANF
  441 -LYEGM-AEAF-KRGAARMAI-VGEDPMLLAEQDAAKVSRAGKANSAAYKPAL-EKIANF
  442 -LYRGM-ADAY-AGGAARLAI-VGEDPMLLSDMDAARVSRAGKATSTAYKPAL-EKISNF
  443 -LYEGM-AKAF-EGGAARMAV-VGDDPMLLADEDPAKVARAGKANSMAYKPAL-EHIANF
  444 -LYEGM-AAAY-RSGAARLAI-VGDDPNLLAGQDPEKIARSNRARSKAYRPAL-ELITAS
  445 -MFEGM-AAAF-RGGAARLAV-VGDDPSLLAGQDAEKVARANRARSQAYRPAL-ELITAS
  446 -LFEGM-AAAF-KGGAARMAI-TGDDPMLLAEQDPAKVARLSKATSIAAKPAM-NPIVGF
  447 -FYEGL-AAAY-KGGAARMAI-TGDDPMLLADQDPAKVARLSKATSIAAKPAM-APIVGF
  448 -LQDGM-ANAY-RKGAARMAI-TGANPVLLANEKAERVSRVGRAASRAGRPAM-ELITRF
  449 -LQDGM-ANAY-RKGAARMAI-TGGNPVLLANENAERVSRVGRAASRAGRPAM-ELITRF
  450 -LHDGM-ATAY-RKGAARMAI-TGGNPVLLANEDPERVSRVARAASRAGRPAM-ELITRF
  451 -LQDGM-ATAY-RKGAARMAI-TGGNPVLLANEDPERVSRVARAASRAGRPAM-ELITRF
  452 -LQDGM-AEAY-REGAARMAI-TGGNPTLLSGENHDRVARASRASSLAGRPAM-ELITNF
  453 -LQDGM-ANAY-RQGAARMAV-TGGSPTLLAGEDPDRVARAGKASSLAGRPAM-ELITNF
  454 -LADGM-ARAF-REGAARMAI-TGANPTLLKGQDPERISRANRANSKANRPAM-EIITQF
  455 -LADGM-ARAF-REGAARMAI-TGSDPTLLKGQDPARIARANRASSAANRPAM-ELITQF
  456 -LAGGM-TEAF-RNGAARMAI-TGSNPALLAGQNPEHISRASRANSRVNRTAM-EIITNF
  457 -LAGGM-TEAF-RNGAARMAI-TGSNPALLAGQNPEHISRASRANSRVNRPAM-EIITNF
  458 -LAGGM-TEAF-RNGAARMAI-TGSNPALLAGQNPERISRASRANSRVNRPAM-EIITNF
  459 -LAKGM-TEGF-RAGAARMAI-TGSDPALLAGQNPERISRASRAASRANKPAM-EIITNF
  460 -LFDGM-AVAF-DNNTARLAV-VGEDPMLLSEQDPENVSKANKAVSIASSPIR-ERITRF
  461 -LYEGM-AAAY-ASGAARMAV-AGANPALLSKEDPEKVGRANRSNSIAYRPAL-ELITKH
  462 -LYDGM-AAAF-KSGAARLAI-AGANPMLLSKEDPDKVGRSNRAVSAASKPAM-ELITRH
  463 -MAEGI-ATAF-RSGAARLAL-SGADPTLLSAQDPAKVSRANIAGSKANKPAM-EMITRH
  464 -MSDGI-AQAF-RSNAARLGI-AGANPSLLKDQDPSKVSRANIAASKASKPAM-ELVTRH
  465 -LQDAI-ATAF-RSGAARMAI-TGANPALLAQQDPSKVSRANIAASKASKPAM-ELITRH
  466 -FCEGL-AKAY-TEDTALLSI-SGDDPLLLVNEDPAKVSRVNRSYLKAYKPVL-EKISNF
  467 -FCEGL-AKAY-SDNTALLSI-SGDNPLLLVNEDSDKVSRVNQAYLKAYKPAL-ERISNF
  468 -FCEGL-AKAY-SDNTALLSI-SGDNPLLLVNEDSDKVSRVNQAYLKAYKPAL-ERISNF
  469 -MVEAR-LKAL-DEGYAWLSI-LADDPEILQGQDPELIRQASQTAARYSKPFS-DRISGF
  470 -RVDAE-IETA-EAGGAVIAI-RATNPNLLGNVDAQRVATYQRTLAAYRKPYT-AQVMTN
  471 -RVDAE-LETA-NDGGAVIAI-RATNPGLLSEVDPQRVATYQRALATYRKPYS-QQVMTN
  472 -RVDAE-TETA-DAGGAVIAI-RATNPNLYAGIDPARVTTHQRALAAYRKPYS-LQVMTN
  473 -RVDAE-LETA-NAGGAVIAI-RATDPNLLAKVDPERVATWQRANATYRKPYS-LQVMTN
  474 -RVDAE-NEVA-DAGGAVISI-RATDPNLLGGVDAERVSTYNRTLAAYRKPYS-RKVMSN
  475 -RVDAE-LETV-EEGGAVLAI-RAADPGLLGGVDAGRVAQQARAYGAYRKAYS-RKVMTN
  476 -LARGM-LETL-EADGARLSV-TGNDPDLLKDQDPELIATAQRRAQTELRPFM-AKVMND
  477 -ATLEA-QKML-GDGYARLRV-VGDDPALFAGVDPARIATRSKLLAQAGREVA-AAVSGF
  478 -VALEA-EKAV-EDGYARLSI-AGDDPSLLSGVNPDRVALRSKLQAQAMKAVS-EAVGGF
  479 -LAQEQ-AAMV-ADGYAFISI-VGEDPSLLAGVNPDRVARRSKALAAARREVS-EAISGM
  480 -ATEQV-QHML-DDGYARLSI-RGDDPALLKNVNPERIARRSKLMAQASREVS-AAVSGF
  481 -VMEQA-ERMV-DDGYARIGI-RGDDPNLLAGVDGQLIAERTKRGAELSRKVS-AAISGH
  482 -FAEER-LHKI-ADGYAFLTL-TGNDPDLLGGVNAERIGVRSKALAIASRPVG-QKMSAF
  483 -FVQAR-VRAV-DAGAALLSL-TDEDPFLLRGVDPARLARRMQAAARVRRPYL-ERVGAH
  484 -LSDGV-VKAY-EGGAARLFV-YGPYPDLLTGVAPERIGRMHAAMAAASAAEG-AFTADL
  485 -LVKGY-EEMA-SSGAAFLYI-ISPHLQNMEGIDLVKVEKAEYASALAFRSFT-EKLIKM
  486 -EIERF-RYLV-DAGWARLSLVGDEFPKALAAVEPNALRTWTVKRARAIKFYT-EAMMAN
  487 -EALFH-NETA-EKGACYLSL-VGEDPDGMKGVDPKLMSNFSKTLRGMTQPYR-DKLDYM
  488 -LGARV-EALG-AARAANISLVGQVRPGAYADIDPARIGRDQLP---ALRQTA-EVINRR
  489 -LGERV-LALG-EARAARIALAGPVAPDLLDGVDPRRTGRDRLP---RLPEDR-QLIDAC
  490 -KHKFF-EEMV-NEKWAKIRIDNTENLDALKDNDSKKISKYFKALSLASKKFS-SAIMNN
  491 -KHKFF-EEMI-NEKWAKIRIDNTENLDTLKDNDSKKISKYFKALNIASRKVS-SAIMNN
  492 -KHKFF-EEMI-NEKWAKIRIDNTENLDALKEYDNKKISKYFQALKLASKNIS-SAMMNN
  493 ------------------------------------------------------------
  494 -KHKFF-EEMI-NEKWAKIRIDNTENLDALKEYDNKKISKYFQALKLASKNIS-SAMMNN
  495 -EKSFL-EEMV-QDKWARINVDDTENFEDLKDNIGQKMSIYQKALNLASKTLS-QAIMSN
  496 -EKSFL-DEMV-QDKWARINVDDTENFEDLKDSIGQKMSIYQKALNLASKTLS-QAIMSN
  497 -EKSFL-EEMV-QDKWARINVDDTENFEDLKENIGQKMSIYQKALNLASKTLS-QAIMSN
  498 -EKSFL-EEMV-QDKWARINVDDTENFEDLKESIGQKMSIYQKALNLASKTLS-QAIMSN
  499 -EKSFL-EEMV-QDKWARINIDDTENFEDLKESIGQKMSIYQKALNLASKTLS-QAIMSN
  500 -EKSFL-EEMV-QDKWARINVDDTENFEDLRENIGQKMSIYQKALNLASKTLS-QAIMSN
  501 -EKAFL-EEMV-QDKWARISVDDTENFEDLKESIGQKMSIYQKALSLASKTLS-QAIMSN
  502 -THAVN-NELL-AYDWARIRIEDNEGLDALKGVDPDGIEAITRTYRQFRAETQ-NHMMND
  503 -LKSFD-YEMC-AENWGYIRIDSTEDRLDHAPLDREKNQILGTAKRQFSSTRF-DKLMRH
  504 -MKALD-YEMC-TEGWSYIRIDSTEERLDHAELDQAKNQILGKAKRRFHEARS-KKLMRS
  505 -QSGIN-ESVI-KDEWAYIAIKTTEDSLDHGPLDPDKYALFSKATRRVNTDVQ-RLRMTH
  506 -RYAIK-EDLL-KNNCAYLEI--RRGIDYFQENQADALQSLKQIENRHNLSFRNKKRQQG
  507 -ITSKK-LSLL-EQNCVFFEA--KRGIDFFDEEKKQELQQLKQIEKKYNLKFRNEKRKVG
  508 -EKEIV------SRVNAQISILSPSHTKPLIGIDPEKLKVRSQARRELNKIYL-ERSAKG
  509 -EKEIV------SRVNAQISILSPSHTKPLIGIDPEKLKVRSQARRELNKIYL-ERSAKG
  510 -EKEVV------SRIHAQISILAPSHTKPLVGVDPEKLKIRSQARRELSKIFL-ERSARG
  511 -EKYML------ENIDASISIISPSHTKPLISIDPEKMKIRSAARRELTKIFM-ERSARR
  512 -EKYVL------ENIDASISIISPSHTKPFIGIDPEKMKIRSGARRELTKIFM-ERSARR
  513 -EKEIV------EKASASISIISPSHTKPLANVDPEKIKTRAQARRELNKIFL-ERSAKG
  514 -EKLLA------EKIDVSISILAPSHTKHLNGVDPERMARRSRARFELTRIYM-ERSARG
  515 ------------------------------------------------------------
  516 -DRAIA------EKARARISILSSTHTKHLINIDPERIRLRSMAIRELREIFM-KRDSTG
  517 -DMYML------EKVDASISIISPLHTKPLATADPGKVARRSRASRPLTELFM-KRDGEG
  518 ------------------------------------------------------------
  519 -IKHLM------KNVDASLKILGNNNTKNLAGVNPEKIKMKAIAQKEISEIVM-NRAAEG
  520 -RKYLI------ENVDAMVRVLGNYNTKGLSNVNPEKISKRSKANKEITEIYM-NRAASG
  521 -HMTAA------KTVKAMINIDCEINTKQLTGVDSGKIATNRKALSVLKDIMF-DREAKG
  522 -SKTAA------ETIDALIVIDSETNTRQLTNVDSKKVAINRKATRILKDIMF-EREAKG
  523 -VMADA------ENITAQVYIDSTDNTKQLTNTDKSKVSLYAKSMRKVRDVLM-DREEKG
  524 -VWADT------HNVTASVYIDATDNTKQLTGADKSKIATYAKSYAKVREVLM-DREQKG
  525 -QRYIT------EHYDATIHLLAEENTKSMTSIDPRKMVAFEKARTDLMETSM-RRTAEG
  526 -QRYIT------EHYDATIHLLAEENTKAMTSVDPRKMVAFEKARTDLMETSM-RRTAEG
  527 -QRYIT------EKYDATIHLLAEENTKSMTSIDPQKMVAFEKARTDLMETSM-RRTAEG
  528 -QRYIT------EKYDATIHLLAEENTKSMTSIDPQKMVAFEKARTDLMETSM-RRTAEG
  529 -QRYIT------EKYDATIHLLAEENTKSMTSIDPQKMVAFEKARTDLMETSM-RRTAEG
  530 -QRHIT------EHYDARFAILAEDNTKKLSTVDPSRMVVFDRARTELMKTMM-RRSAEG
  531 -HHYAA------ENFDARIRIYSEGNTRGLNSVNPARQARRQKALSVVQRAVF-RRAAED
  532 -RLLAY------EQFEGRIRIHSATNTRGLSGIPPQRLQRRQKALGRITETQM-RRGAEG
  533 -MPALA------DKITARLTIMASGNTKAMSNIDPARLSKRHQVGRQLMSTFR-QREQEG
  534 -DRLGI------ETADVRIRIDAQSNTRELSQVDPERQSVFQKSRRELMGTLM-SRTHAG
  535 -DRVAF------EQYQHAMVIHAPHNVKALSGVDPRRLAIVHEARRQLADRLM-ARIGQG
  536 -ERIAF------EEYRHALVIHAPHNVKALSGVDPRRLAIMQEARRPLADKLM-SRIGQG
  537 -MRQEI------EEINATIRIMASENTRALSGIDPRKVALRRQALSDLQKRVM-QRSAEG
  538 -MRQEI------EEINATIRIMASDNTRALSGIDPNKIALRRQALSDIQKRTM-QRSAEG
  539 -ERLGP------EQADALLRILSESNTKALTGVDPARQQLHQRARTELRQTYL-ERAAAG
  540 ---------------------LSESNTRALTGIDPARQQLAQRARTELRQTYL-ERAAEG
  541 -EAFAS------LEADARLSVIAPENTRMLAGIDPARQQVFSRARASLRERHL-ERAAQG
  542 -ERQEI------EYFDAMLRIMADENTKSLTNVDPNKLAIAQQARTDIMRRYL-ERAATG
  543 -RRQMV------EAANASLRVYSEENPLSLSGIDPARIAKHRKAWRELSEIRL-GK----
  544 -EVAVM------EAVDASLRVISAENPLDLADVDPESLARHRKAWRPLSEARL-RK----
  545 -ELALY------QRADKFLRVLSAENPLEAAAVDPALALRRQRAWRLLQEIRL-GK----
  546 ----------------------------------------HQRAWRPLSELRL-QK----
  547 -ERALY------EKADKFLRILSAENPLEGASLDPGLSLKHQRAWRPLAELRL-NK----
  548 -QMQLM------EQVDASLRIESAQNPLELSEVPPARIAQFEAGWRPYKRMRA-RK----
  549 -AHAEA------AQADAFLTIQAPENTRALADVDPARLSRATRARAPLTELRM-QK----
  550 -ERALV------AASDAFVRVLSPSDPFAAAGVDGERLARHRKAWGALRPPHG-------
  551 -DLADV------EALDGSLRILTPEAP---VSGDAERRARLTAARAPITAARA-RK----
  552 -DVADV------EALDGSLRVLTPEPG---QPGDAARRARLMASRAPVAAARA-RK----
  553 -ELDDM------RGMDGSLRILTPEAA---QPADAARAARLLASRAELAALRS-QK----
  554 -DVQNM------TAMDGTLRVKAPEHP---QGGDPKRQARLIASGARLAAARA-QK----
  555 -DLADM------EAIDGSIRVLAARAL--ASDVDPARRSRLMKAAAPLAGARS-RR----
  556 -ELAEI------RHTHAWLRVAAPTNSRALQSADKTKLGKLQTRNRPVQNLRL-KT----
  557 -VRALY------ERADAFVNILAPTNTRALAGVDPEKQQALSRRDKELSDMVL-KRD---
  558 -LAYEA------ETVPCRIRIAAEIDTRSMAQVDPRRQAIRDRALGNLRELSR-RN----
  559 -ALYEA------QTIDGRIRISAESDTRSMSRIDPARQAIVDKARDPIRRAAS-RK----
  560 -LVHEI------ETMTTWCDIYSEINTKHFNQADQQRQLLRRKAFGPVQVLFD-SRAAQN
  561 -TQYIA------DHCDLYLAIGAEGNSKLLSGVDPKRQAMASQARQPVLEAIL-NRAAAG
  562 -IEALY------EEMDAYIAIKGSDNVTETSDVDPETTAAYQQSQQPLLNERL-SK----
  563 -IEALY------EEMDAYIAIKGSDNVTETSDVDPETTAAYQQSQQPLLNERL-SK----
  564 -VQALY------DEMDVYIAIRGGGNATETSDVDPETTAAYQQAQQPLLDERL-SK----
  565 -ELALI------ENTDVYIAIRASDNVTQTSDVDPETQAAYQQAHQPILEERL-GI----
  566 -ELALI------QNTDVYIAIRASDNVTQTSDVDPETQAAYQQAHRPILEERL-SK----
  567 -ELALI------ENTDVYIAIRAGDNVTQTSDVDPEVSAAYGKAHRPILNERL-ST----
  568 -EQALM------DETDAFIHLRATENATETGDVDPETTAAYSVAQQPIREERL-SK----
  569 -LKALY------EETDVLIRVRGEANATEQSDVPPETQAARSKAYQPVQEVAL-SK----
  570 -----------------------------LEDVPPEVNSDYEKAHQPILNERL-TD----
  571 -EQALV------EAADCHAVIRSHVNVTELEDVAPEVNSDYEKAHQPILNERL-TD----
  572 -ERALF------EAADAIVHVRAHENASDMSDVDAETHAAYNQAYQPIQQEIL-SS----
  573 -LLAMY------EEMDAYIAVRGDVNASETADVDPETNAAHRRAMQPVLEERL-SK----
  574 -LLALY------QEMDTYIAIRGDENATETADVNPETNAAYRRAMQPVLQERL-SK----
  575 -VLALY------EETDVIIRVRGETNATEQSDVPPETNAAYKRAYKPVQGEML-SK----
  576 -RRALY------EEADVFIIARGGSNATEDADIDPETNAAYNRAMEDVKRTRL-SK----
  577 -ELALY------ENADVTIIARSGPNPSEKADVDPETTAAYNRAHDPVKKARL-DT----
  578 -LLQLY------EHADAAVVGRPHRNVTEQSDVSTELGAAFAEAHRDVLNARL-ST----
  579 -LLQLF------KHADAAVVARPHENVTEQSDVSTEMGAAFGRAYREVLNARL-ET----
  580 -TLALY------EACDVAIHVRSSPNLAALNDVSGTRLAERSRAHKPIIEERL-SK----
  581 -ERALY------ANADSVLLLGGTRNTAGRGDVPDDRQQAFARAREDIREARL-AT----
  582 -ERTLY------ENADSVLVLKGTRNTAGMADVPDDRQQAFARAREEVREARL-AT----
  583 -ERALY------ERADSVLSLGGSRNTAAASDVPGDRRQSYRRARTEIRAARM-DT----
  584 -ELALY------ERADSVLFLKGSRNTTETADVDSDQRQAYSTARQEIREARL-DT----
  585 -ELALY------ERADSVLFLKGSRNTTETADVDSDQRQAYSTARQAIREARL-DT----
  586 -ERALV------EHADVCLFIGGGRNTSAAADVPATTREAYNTAHGEIREARM-DT----
  587 -LLALM------ENADVVLSIGGGRNASEGSDIPPETQQAQSKARQGIREAYM-DT----
  588 -ELALV------ENADVYLSLGGGRNTSATADVPGERRRAYNNARTDIRETRL-GT----
  589 -ELALV------ENADVYLSLGGGRNTSATADVPGERRRAYTEARNEIRETRL-GT----
  590 -ERALF------ENADVYLSLGGGRNTSATADVPGDTRRAYSNARTEIREARF-DA----
  591 -ERALM------EETDVYLSIRGGRNTSATADVPGETRTAHRQARDEIREARY-DT----
  592 -EHALL------EEADVYLSIGGGCNTSATADVPGEVRSEYRDARTAIREARY-DT----
  593 -ELALY------ENADSVLFLGGGRNTFATADVPGETRQASDRASQPVREARM-DT----
  594 -ELALY------EAADSVLFLGGTRNTAATADVPTETQQAYGRATSEVKEARM-DT----
  595 -ELAMY------ENADVVLRLAGSTNTTAQADVPGETKQAYNKARMDIRKARL-DA----
  596 -ERALY------DAADSVLILGGDRNTTATADVSGDTKQAAAQANKQIREARM-ST----
  597 -ESYGM------EWADVYIGLRGAANLNECWAVPADKLSKLRRALGKLSTLRW-QKT---
  598 -EAYGM------EWADVYFGLRGFRNPYELWDVSPERLAINQIAMGKISTLRW-EKT---
  599 -ESAAM------GWSDVHVSFRAMSQ--PVVDADPGRIAALRRGRGVVSTMRW-QNT---
  600 -DKERM------EKMQACIIIEGGLNINEMSDVPGEQMKLATSFSKEVSIV---RLKK--
  601 -DYERM------KAMDCYVAIRGRENINELADVPSDRMKIYAERYNHRVHEE--RVNNT-
  602 -DLERM------EKMQGYIGVRSGSNVNELSDVPKEKMRLYEQLYTHPVHMEE-RVKRT-
  603 -DLERM------KKMDCYIGIRAGENVNDMADVPEENMKLYNALYSHPVHSEE-RVKRT-
  604 -DLLRM------KDMNCYIGVRAGENVSEMSDVPEEKMKLYSQIYSKQVHLEQ-RVKKT-
  605 -ELERM------RKMDAYVGVRSGENVTETSDVPEEKMKMFMSLYQRPV-TNE-RVNNT-
  606 -EYDRM------KDMDAYIAIRAYDNINEYADVPDDKMGIYARVLYQPVHTNE-RVPNK-
  607 -EAARM------EDMDAYIGIRSGNNSAELSDVPQDKLELYNKYFINEVHMKI-RVPKT-
  608 -ESARM------KQMDAYIGIRSGDNASELSDVPAEKMELYFKHYWNKVHGDI-RVNQT-
  609 -ESARM------SDMDAYIGIRSGNNASELADVPSERMELYFKHFWNEVHGNI-RVNRT-
  610 -ELERM------KDMDAYIGIRSGDNVSEKASVPSDKMKIYMSLFSKPVHSEQ-RVEHT-
  611 -ESERM------KAMDAYIGIRASDNVSELSDVPPEKLQLYQQHWSKPVHTDI-RVPFT-
  612 -DSERM------KDMNAYIGIRGGDNVAELSDVPHDKKSLYMQLYVKPVHGDI-RVPRT-
  613 -DLARM------KDMQAYIGIRAGENVNELADVPSEQMKIYMSHYSQPVHSEQ-RVKHT-
  614 -DLARM------KEMQAYIGIRGGENVNEWADVPSECLKIYTSHYQKAVHSEQ-RVPHT-
  615 -DLARM------KEMDAFVGIRAGENANELSDVPGDKMTIYQKEYLRTV-MEQ-RVSHT-
  616 -ELERM------KDMDAYIGIRAGNNTGEMSDVPGEKLKIYSEKLVGPVHIQE-RVGNT-
  617 -DVAFM------KQMDCYIGIRGGDNISELSDVPGDKMQLHSKLLARPV-LDI-RVPHT-
  618 -EVELM------EKMQGYIGIRAASNINEMADVPSDKLSIYSRLYELPV-MNV-RVPKT-
  619 -EATMM------EKVDAYIGLRSGDNISELSDVPGDKLALWGKTVGTKVHREI-RVPKK-
  620 -EAQVM------SEMDAYIGLRAGDNISELSDVPSDKMALHGKTVGTKVHREI-RVPKT-
  621 -EANVM------GKMDAYIGLKSGDNINEHADVPDDKMKIHGSTIGKKVHREI-RVPKT-
  622 -EANVM------KEMDAYIGLRAGDNINEFADVPADKMKIHGKTIMQKVHRDI-RVPKT-
  623 -EANVM------KEMNAYIGLRSGSNIFEQSDVPTDKMKIQGNTIGKKVHREI-RVPKT-
  624 -EASVM------DKMDAYIGLRSGDNINEHADVPDEKMKIQGNTIGKKVHREI-RVPKK-
  625 -EASVM------KDMDAYIGLRSGDNINEQADVPSERMKVHGQTVGKKVHRDI-RVPKT-
  626 -EASVM------KDMDAYIGLRSGDNINEQADVPSERMKVHGQTVGKKVHRDI-RVPKT-
  627 -EASVM------KDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDI-RVPKT-
  628 -EASVM------KDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDI-RVPKT-
  629 -EASVM------KDMDAYIGLRSGDNINEQADVPSERMKIHGQTVGKKVHRDI-RVPKT-
  630 -EGNVM------KEMDAYIGLRAGDNINETSDVPAAKLKIHGDTVG-KMHSHI-RVKKT-
  631 -EGNVM------KEMDAYIGLRAGDNINETSDVPADKLKIHGDTVG-KMHSNI-RVKKT-
  632 -EGNVM------KEMDAYIGLRAGDNINETSDVPADKLKIHGETVG-KMHSDI-RVKQT-
  633 -EGNVM------KEMDAYIGLRAGENINETSDVPADKLKTHGETVG-KMHSDI-RVKQT-
  634 -EGNVM------KEMDAYIGLRAGDNINETSDVPADKLKIHGETVG-KMHSDI-RVKQT-
  635 -EQKQM------QAMDAYIGLRAGDNINELSDVPSDKMKLYGQTLG-KMHTED-RVKGT-
  636 -ERKQM------QAMDAYIGLRAGDNINELSDVPSEQQKLVGATLG-KMHTED-RVKGT-
  637 -EATVM------KEMDAYIGLRSGDNINELSDVPSENMSLHQQTVGTKVHRQI-RVPHT-
  638 -EATVM------KEMDAYIGLRAGDNINELSDVPDEQMALHQKTVGTKVHREI-RVPKT-
  639 -DGQEM------SQMDCYIGIRGGDNVSEKSDVPAEKLNLYEQYYSTPVHGNI-RVPKT-
  640 -ERDLM------EKMDAYIGIRSSPNPFELSDVPDEKMNLYQRIWFHKVHGEV-RVPKT-
  641 -ERDLM------EKMDAYIGIRSSPNPFELSDVPDEKMNLYQRIWFHKVHGEV-RVPKT-
  642 -ERDLM------EKMDAYIGIRSSPNPFELSDVPDEKMNLYQRIWFHKVHGEV-RVPKT-
  643 -ERDLM------EKMDAYIGIRSSPNPFELSDVPDEKMNLYQRIWFHKVHGEV-RVPKT-
  644 -ERDLM------EKMDAYIGIRSSPNPFELSDVPDEKMNLYQKIWFHKVHGEV-RVPKT-
  645 -ERDLM------EKMDAYIGIRSSPNPFELSDVPDEKMNLYQRIWFHKVHGEV-RVPKT-
  646 -ERQLM------EKMDAYIGIRSSQNPFELSDVPDDKMALYQKIWFHKVHGEV-RVPKT-
  647 -EKSLM------EQMDAYIGIRAGDNIAELSDVPEEKIQAYQRDWWHPVHGEV-RVPKT-
  648 -DLMLM------KEMDAYVGIWGGLNSSESSSVKMENHAIYEKFYLDPVHMKE-RVKNT-
  649 -DLMLM------KEMDAYIGIWGGLNSAENSSVKIENNKIYEKFYLNPVHMKE-RVKNT-
  650 -ELAEM------SRMDCFIGFTAPQNLSAWSDVPQEKLDLYNTVYYHPVHLER-RLNHT-
  651 -ELYQM------KGMDAYIGIGCSDNASELSDVPSDNISLQSSVLRPVLRE---RVDNS-
  652 -AMNEM------KQMQAYLSIRAMNNAMENCDIDDKKMLAYRTITQDVLNY---RVNNT-
  653 -ELARM------EQMDAYIAVRGSDNIFEMSDVDPKKMSHAMRAMKPVLDH---RVNKT-
  654 -ELARM------QKMDAYIALRGSDNIFEASDVPADRVQLVSRLMKPVLDH---RVGKT-
  655 -ELQRM------KNMDAYIALRGSNNIFEASDVPGEQAQLVSQVMKPVLDW---RVNKT-
  656 -QLAQM------KKMEAYIAVRGGDNITELSDVPPEKMKLLSKKMKPVLDW---RVKKT-
  657 -EMFRM------KKMQAYIAIRGSANASETSDVASDRMSLYSRIMRPVLNY---RVNKT-
  658 -DAARM------REMQAYIGIRASENSADFSDVAEAALERYQQIYMKPVHFEI-RVPHT-
  659 -EKDLW------FGIQGYIGIHGETNDSEMKDVPQEKYRLYAEAYDSIFHHVDNQI----
  660 -EEPMY------KDLDTYIVINGPSNDSEMADVPVERRRAHQSVMQEL--HDY-LTNNV-
  661 -ESDRM------KKMDAYIGIRASWNELEMGDIGADKSSLYRTNYVQPVHFGI-RVPHT-
  662 -DSYRM------KTVDAYIGIRGIANVRELASIPS-QVALSSKLYNTPVHRDI-RVPHT-
  663 -RLAEM------EDMDAYIEIRGGGNAFELSSVPQENMAAAMKAL-NPV-SQR-RIRHT-
  664 -DRHRM------EDVQAYLGLRGARNIGEMSDVPSGRMSAYSTHYLKPVHLES-RIKST-
  665 -KLAQM------KEMDAVIAILGENNISEFADIPSDKRNIYRKAYKPVSDEQL-KK----
  666 -KLDFY------KTLTVYIGIAAGENSMVMANARQEAIVTYQKVTKPLIDQ---RVKHT-
  667 -KLDFF------KTLTAYIGISAGENSMVNATSNQKAMVAYSKLTRPLVDQ---RVKHT-
  668 -KLDLM------KKVDVYIALSAADNSMVMAQADQTKMIAYSKVIRPIIDW---RVKNT-
  669 -KLDQM------KKADVYIGLSAADNSMVMAKADQKKMIAWSKLVRPIVDW---RVKNT-
  670 -KLDFM------KQVNVFISISGSPNSMVMAQANQKNMIAWSKVTRPIVDW---RVKNT-
  671 -KLDFM------KQADVYIGLTASDNSMVMAKAKQASMIAWSKVVRPIIDQ---RVKHT-
  672 -KLDFM------KQANVYIGLTASDNSMVMAKAKQVSMIAWSKVVRPIIDQ---RVKHT-
  673 ------------------------------------------------------------
  674 -DKEFM------RRLNANIALLAPESLTHLKDVDSKRIGKTAIARKQLRDILD-EREAEG
  675 ------------------------------------------------------------
  676 -----------------------------LSGIDPKRIATAALARKPLRDILV-RREEKG
  677 -----------------------------LSGIDPKRIATAALARKPLRDILV-RREEKG
  678 ------------------------------------------------------------
  679 -QAELH------ENLHGAMHLLGPDSLTHLSGVDPKRIAAAAVARKPLRDILV-RREERG
  680 -DKELV------GNLNGLISLIAPASLTHLQDVDPKKIGQAAVARKFMRDIME-QREQTG
  681 -DREFV------GGLNGLISLIAPASLTHLQNIDSKRIGQAAVARKFMRDIME-KREQSG
  682 -EEEFT------EGLNGLIVLLAPSSLTHLAGVEPSRMGKCAVARKFLRDIME-KREQKG
  683 -DRELY------EHLAGLISLLAPDSITHLKDIPPTKIATFSLARKYLRDILD-KREATR
  684 -EKELV------DNLSGLVSILAPQSLTHLSHVDPASFGMFQKSRKFLRDIMD-RREEQG
  685 -----------------------------LRGVDPKKIGKATVARKHLKDILD-KREEEG
  686 -DRELI------KNVNGNISLLAPDSLTHLSTIDPMKIGKAAAARKPLRDILD-KRESNG
  687 -DEELF------QNINGSISLIAPESLTHLAHIDSSKMGKAAVARKPFRDILD-KREQDG
  688 -ERELY------ASLNGRIYLHAPESLTHLADVDPAVIARVQLSRKFLRDIFN-EREDQG
  689 -ERDLY------SHLGGCITIIAPESLTHLASIEPERIAMAQAARRPLQDIAH-LREDMG
  690 -------------HLGGCITIIAPESLTHLASIEPERIAMAQAARRPLQDIAH-LREDMG
  691 -ERELQ------NRLNGTISLLAPQSLSHLASVPAENIALAQRARAPLTAIAR-TREQMG
  692 -ERDLH------NHLHGTISLLAPQSLTHLSGVEPERLAMHQQSRQPVQHITR-TREEMG
  693 YHKGTV------DQIDHTVAILAETNKKELEGIDSKKIMATQKALKPYMDWRR-EKESAG
  694 --------------------------PRKMHGEEPPKPVAEAMKVAD-------------
  695 --------------------------PRPLKDMPAEVLADMETSHVSI------------

      14        15         16             17         18          1
      901234567890123456789A01AB23AB4A56789012345678A9012AB3456789
                                                                  
                                                                  
    1 QVQWVVAAVPGKEWAKQVFPE-KS--EA--Q-AMESLWEAIFCAVR-IQDG--DAVQAWR
    2 QVQWVVAAVPGKEWAKQVFPE-KS--EA--Q-AMESLWEAIFCAVR-IQDG--DAVQAWR
    3 EFQWCVVAVPERKWAQKVFPE-LG--EQ--E-AIEKLWDAIFEAVR-IGQD--DAVKAWN
    4 RIRWCVISVPTVGWARKVFPD-IP--KS--A-AVEQLWNAIFETTR-TNLT--DPAAAWH
    5 ECRWCVVSVPTVGWAAKVFPG-VE--PE--T-AVDMLWESIFKATR-ADQD--DPIAAWH
    6 QNTWCVVSIPTAAWAAKVFPH-LS--AE--E-SIEKLWEVIFQTVR-VDTE--NPILSWQ
    7 QNTWCVVSIPTAAWSKKVFPH-LS--EE--E-SMEMLWDAILKTVR-VDAE--NPVLAWE
    8 KNTWCVVSIPTAAWSKKVFPD-LS--ED--E-SIQKLWETIFKTVR-VDTD--NPVASWE
    9 QNVWSVVSIPTEAWAKKVFPS-LP--SN--E-AINKLWETIFMTVR-VNTE--DPIKSWN
   10 KNVWCVISVPTASWAKKVFPQ-YD--EA--K-GIEKLWDAILKTVR-VDQS--DPLKAWE
   11 QNSWCVVSVPTQAWAQKVFPA-AG--PE--A-AVEKLWEAIFASVR-ADQD--DPVQAWD
   12 QNAWCVVSVPTLAWAQKVFPD-AS--PE--G-AVEKLWDAIFTSVR-ADQN--DPVKAWD
   13 QNPWCVISVPTQAWAQKVFPN-AS--RD--E-AMDKLWGAIFKAVR-ADQE--DPVQAWE
   14 QNAWCVVSIPTDSWAVKVFPA-LP--AP--Q-AVAALWEAILKAVR-VDAP--DPVAAWE
   15 KNVWCVASVPTKAWAKKVFKD-VS--ED--E-AVEKLWNAIFKAVR-ADKD--DPIEAWN
   16 KNSWCVVSVPTKSWAKKVFED-LS--EE--K-AVEKLWDTIFKTVR-ADKP--NPINAWD
   17 KNTWCIASVPTAAWAKKVFPD-VS--ED--E-AVERLWDAIFKAIR-VDKE--NPVAAWE
   18 KNPWSIISIPTEAWAKKIFPE-LS--CH--D-AVSTLWDNIFKIMR-IDKE--DTILAWE
   19 KNAWSIVSIPTKAWAKKVFSD-LP--EE--E-AVDKLWNEIFKIVR-VDTE--NPVEAWN
   20 YNQWCVVSVPTDAWAGKIFPE-LT--KE--E-SKGKLWNLIFSIVR-ADKE--NPIEEWK
   21 YNQWCVVSVPTDAWAGKIFPE-LT--KE--E-SKEKLWDLIFSIVR-ADKE--NPIEEWK
   22 YNQWCIVSVPTDAWAGKIFPK-LP--RE--E-SKEKLWELIFSIVR-ADKT--DPVKEWE
   23 SNQWSVVSVPTKAWAMRVFPE-LR--EE--F-AIAEMWKLILKIVR-ADKE--NPILEWE
   24 FVSWCVLSVPTKAWAKKVFPD-LK--ED--M-AVEKLWENIFNIVR-IDKE--DPVKAWE
   25 FVSWCVLSVPTKAWAKKVFPD-LK--ED--M-AVEKLWENIFNIVR-IDKE--DPIKAWE
   26 KVSWCVAAVPSPSWAKKIFPD-DT--TE--N-AIEKLWDKIFIANR-VYDE--DPVVSWD
   27 EVSWCVVSVPTKGWAKKVFPN-VP--EE--E-AVEKLWQSIFSIVR-ADKE--SPVAAWE
   28 EVQWCVVSIPTKGWARKVFPD-LS--EA--D-AVENLWDSIFSIVR-ADKE--SPIEAWN
   29 RNTWCVVSVPTKGWAKKVFPD-LS--ED--E-AVARLWREIYKTVR-VGEG-IDTIQAWQ
   30 KNTWCVVSVPTKGWAAKVFPE-DM--EE--A-AVEKLWQAIFQTVR-IGEG-VDTVEEWQ
   31 KNAWCVVSIPTESWAKKVFPE-DA--PD--A-AVENLWQAIFDAVR-LAPG-EDAAARWQ
   32 KNTWCVISVPTTAWARKVFPN-CS--DA--E-AVERLWGEILSAVH-VSEN-EDAVSAWR
   33 KNTWCVVSVPTAAWAHKVFPN-CS--EA--E-AVEQLWAQILSAVR-VSAE-GDPIAAWQ
   34 QNTWCVVSVPTAAWACKVFPH-ET--EE--T-AAARLWTEILRAVR-VSEE-SDPVAAWK
   35 QNTWCVVSAPTPAWACKVFPH-ET--EE--T-AVARLWTEILRAVR-VSEE-SDPVAAWK
   36 KNSWCVVSVPTPAWAHKVFPD-VS--AD--Q-AMERLWAEILKAVR-ISAE-EDPISAWM
   37 KNSWCVVSVPTPAWAHKVFPD-VS--AD--Q-AMERLWAEILKAVR-ISAE-EDPISAWM
   38 RNTWCVVSIPTPAWARKVFPE-AA--EE--T-AVARLWEEILKAVR-ITPE-NDPVAVWK
   39 RNTWCVVSMPTPAWARKVFPE-AA--EE--T-AVARLWEEILKAVR-ITPE-NDPVAVWK
   40 KNAWCIVSIPTENWAKKVFSE-SN--SS--E-AIEKLWDAIFTVMR-LKES--DPIDAWN
   41 ENAWCIVSVPTEGWANKVFKN-SN--SK--E-AIEQLWDAIFTVMR-IKEE--DPVKAWN
   42 KNAWCIVSIPTDGWAKKVFPN-VS--VE--E-ATEKLWDVIFSIMR-LKEN--DPIEAWN
   43 KIRWTVVSVPTEAWALKVFKN-SN--SE--E-AVSKLWDVIFNVVR-LNND--DPIKAWE
   44 QVCWCVVSMPTPSWSKKVFPD-AR--EE--E-REAMLWDKIFTATR-IYEE--DPVAAWK
   45 GFPWCIASIPIPSWAKRVFPN-VG--EN--E-AMEKLWNAIFAAVR-ISGD-GNAVEKWR
   46 KVCWSIIATPTPEWAAKVFPE-VA--EE--K-QVETLWNSIFKATR-VITD--DPVKAWS
   47 RISWLIAAVPSVAWAKSVFPE-LS--EE--K-AVEELWEKIFYTTR-VDQE--NAVQLWK
   48 KVSWTIISVPTQAWSKKIFPD-LA--AD--E-RMDALWKQIFAITR-ADAA--DPEAAWK
   49 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   50 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   51 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   52 KVSWCVISVPTKEWAAKVFPD-AA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   53 KVSWCVISVPTKEWAAKVFPD-AA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   54 KVSWCVISVPTKEWAAKVFPD-AA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   55 KVSWCVISVPTKEWAAKVFPD-AA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   56 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QEAKLWDAIFKATR-ADLE--NPVEAWK
   57 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QETKLWDAIFKATR-ADLE--NPVEAWK
   58 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QETKLWDAIFKATR-ADLE--NPVEAWK
   59 KVSWCVISVPTKEWAAKVFPD-VA--PE--E-QETKLWDAIFKATR-ADLE--NPVEAWK
   60 KVSWCVISVPTREWAAKVFPD-VA--PE--E-QQEKLWDAIFQATR-ADLE--NPIEAWK
   61 KVSWCVISVPTKEWAAKVFPD-VS--PE--Q-QEAKLWDAIFQATR-TNLE--NPVEAWK
   62 KISWSIVAVPSKDWAAKVFPD-VP--EE--Q-QQEKLWEAIFKSVR-VDQE--EPVAAWE
   63 KVSWTVVGAASEGWAQKVFPG-KS--KE--E-AIHLLWEEIFKATR-VNED--NPVQAWI
   64 KVSWTVVGAASAGWAHKVFPG-KS--EE--E-AIHLLWEEIFKATR-VNED--NPVQAWI
   65 KVSWTVIGAASAGWASKVFPG-HS--EE--E-AIQLLWEEIFNTTR-VNEE--NPVQAWK
   66 KVSWTVIGAASTGWAKKVFPD-QP--EE--T-AVELLWEEIFKTTR-VNEE--NPVEAWK
   67 KVSWTVIGAASTGWAKKVFPD-QP--EE--T-AVQLLWEEIFKTTR-VNEE--NPVEAWK
   68 KVSWTVVAAPSPAWAKKVFPE-AD--EE--T-AVQKLWNEIFKTTR-VDRE--DPVQAWK
   69 KVSWTVVAAPSPAWAKKVFPE-AD--EE--T-AVQKLWNEIFKTTR-VDRE--DPVQAWK
   70 KVSWTVVAAPSPAWAKKVFPE-AD--EE--T-AVQKLWNEIFKTTR-VDRE--DPVQAWK
   71 KVAWTVVGAASKDWAKKIFPD-QT--DE--E-AIALLWDQIFKVAR-ADQA--DPVEAWK
   72 KVSWTVIAVPSEGWADKVFAD-DP--KE--S-RVEKLWDAIFKATR-ADLE--DPVQAWK
   73 KVSWTVIAAPSKAWANMVFPD-AP--EE--S-RVDMLWEAIFKATR-ADLD--NPVEAWK
   74 KVSWTVIAAASDAWAEKVFPE-AS--TE--T-KVQKLWEAIFKATR-VDTD--QPVEAWT
   75 KISWTVIAAPSEAWAEKVFHH-EP--KE--T-RVQMLWDAIFKATR-TDLE--DPVKAWK
   76 KVSWSVLAAPSEKWAAKVFPD-EP--AE--E-QVDKLWDAIFKAVR-ADQQ--DPVQAWK
   77 KVSWTVIAAASQAWAKKVFPN-----EE--K-PVEKLWEAIFDAVR-IGQA--DPIAAWQ
   78 KVSWCVLAVPSPAWAAMVFPH-LP--QE--E-QEPALWDAIFRATR-ADMD--DPVQAWH
   79 KISWTVIAAPSKQWARKVFPE-LP--EE--K-QVEALWDAIFKATR-ADLD--NPVEAWA
   80 KISWSVLAAPSENWAAKVFPE-LP--KE--Q-QVDALWDAIFKAVR-ADLD--QPIEAWS
   81 KFSWTVIAAAAPAWAAKVFPD-NS--AE--D-QVPALWDAILRAVR-ADQP--NPVEAWQ
   82 KFSWSVIAAPSKAWAAKVFPD-LP--ED--Q-QMDALWEAIFAATR-IDLE--HSVEAWL
   83 KFSWSVIAAPSKAWAAKVFPD-LP--ED--Q-QMDALWEAIFAATR-IDLE--HSVEAWL
   84 KFSWSVIAAPSKAWAAKVFPH-LP--EE--Q-QMDALWEAIFAATR-IDVE--NPVEAWH
   85 KVSWTVVGAASADWAAKVFPD-AG--RE--E-AVEKLWDAIFASVR-LHAD--DPVQAWE
   86 KVSWTVVAAATKDWAVKVYPD-AG--PE--E-AVSKLWEAIFKAVR-LHAE--DPVQAWK
   87 KVSWTVVAAAGKAWASKVFPN-VN--EE--E-AVNQLWEAIFKAVR-LHSV--DPVKAWE
   88 QVAWTVVAAASEAWATKVFPN-VE--PA--Q-AVDQLWKAIFDSVR-LNTP--NPVEAWA
   89 KFSWCLVAVPSAAWAAKVFPD-VP--ES--E-QVGKLWEAIFHTVR-VDQE--NPVEAWN
   90 KFSWCLVAVPSAAWAAKVFPD-VP--ES--E-QVGKLWDAIFHTVR-VDQE--NPVEAWN
   91 KFSWCLIAVPSAPWAAKVFPD-AP--ES--E-QVSKLWDAIFHTVR-VDQD--NPVEAWN
   92 KFSWCLIAIPSPAWAAAVFPD-VP--ES--E-QVQKLWDAIFHTVR-VDQE--NPVEAWN
   93 KFSWALIAYPSEEWAAKVFPN-LP--AS--E-QMDKLWEAIFSTVR-VDLD--NPVEAWK
   94 KFSWSLIAYPSAEWAAKVFPD-LP--AS--E-QMDKLWDAIFSTVR-VDLD--NPVEAWK
   95 KFSWSLVAYPSAEWAAKVFPN-LP--AS--E-QIDKLWEAIFSTVR-VDLD--NPVEAWK
   96 KFSWSIVAVPSKAWADKVFPN-LP--EE--E-RVQALWEAIFRTVR-LDQP--DPIAAWQ
   97 KFSWCVAAAPSKAWAAKVFPG-LS--EE--E-QVAKLWEAILRTVR-VDRE--DPVAAWE
   98 KMSWTGIAYASPDWASKVFPD-VP--AG--Q-QVDKMWDAIFHAVR-ADLE--DPIGAWE
   99 KMSWTGIAYASPDWASKVFPD-VP--AD--Q-QVDKMWDAIFHAVR-ADLE--DPIGAWE
  100 KMSWTGLAYASPDWAAKVFPD-VP--QE--Q-QVDKMWDAIFHAVR-ADLE--DPIQAWE
  101 KMSWTGVAFASPDWAAKVFPD-VP--KE--L-QVDKMWDAIFHAVR-ADLD--DPISAWE
  102 KISWSIVAVPSKGWSAKVFPE-LS--EQ--E-QEEKLWEAIFHATR-ANLE--DPVQAWM
  103 KISWSIVAVPSVEWAEKVFPD-TK--GE--E-AVQKLWDAIFAATR-IHNE--DPVADWK
  104 KVSWSIVAAPSEGWAKKISPD-ES--KD--R-AVEKLWEAIFAATR-TDQA--DPVAAWK
  105 KVSWSIVAVPTVSWAEKVFPD-AK--GE--E-AVTKLWEAIFAATR-INET--DPVAAWK
  106 KVSWLVFSTPSKSWAAKVFPG-VP--EE--Q-QEEKLWEAMFETVR-INTA--NPVTAWK
  107 KVSWLVISAPSQAWAEKVFPE-AK--GE--E-AMNKLWEAILETVR-VNTE--DPVAEWK
  108 VVSWTVVAAASQGWAAKVFPD-LT--PE--E-QMATLWEAIFETTR-INTE--NPVETWK
  109 VVSWTVVAAASQGWAAKVFPD-LT--PE--E-QIATLWEAIFETTR-INTE--NPVETWK
  110 VVSWTVVAAASEGWAAKVFPD-LT--PE--E-QMATLWEAIFETTR-INTD--NPVETWK
  111 VVSWTVVAAASQGWAAKVFPD-LT--PA--E-QMETLWEAIFETTR-INTE--NPVETWK
  112 VVSWTVVAAASQGWAAKVFPD-LT--PA--E-QMETLWEAIFETTR-INTE--NPVETWK
  113 VVSWTVVAAASQGWAAKVFPD-LT--PA--E-QMETLWEAIFETTR-INTE--NPVETWK
  114 VVSWTVVAAASQGWAAKVFPD-LT--PA--E-QMETLWEAIFETTR-INTE--NPVETWK
  115 VVSWTVVAAASQGWAAKVFPD-LT--PV--E-QMETLWEAIFETTR-INTE--NPVETWK
  116 VVSWTVVAAASQGWAAKVFPD-LT--PE--E-QMETLWEAIFETTR-INTE--NPVETWK
  117 TVSWTVVAAASEGWAKKVFPD-AA--ES--E-QVDKLWEAIFQNTR-IHTD--DPVATWK
  118 TISWTVVAAASNGWAQKVFPD-LP--LE--K-QVPTLWEAIFETTR-INTD--DPIATWK
  119 NVSWSIVAGASEAWAQKVFPG-----RD--D-AVAALWQAIFAATR-MDQE--DVVAAWD
  120 NVSWCVIAAPSDAWAAKVFPD-----SE--H-AVEDLWEAILKATR-VDQD--NPVAAWE
  121 RNCWSLISVPTPAWAQKVFGD-LR--DE--E-AIDKLWEAIFRITR-IDHD--DPIAAWR
  122 RNCWSLISVPTPAWAQKVFGD-LR--DE--E-AIDKLWEAIFRITR-IDHD--DPIAAWR
  123 RNCWSLISVPTPAWAQKVFGD-LR--DE--E-AIDKLWEAIFRITR-IDHD--DPIAAWR
  124 RNCWSLISVPTPAWAQKVFGD-LR--DE--E-AIDKLWEAIFRITR-IDHD--DPIAAWR
  125 RNCWSLISVPTPAWAQKVFGD-LR--DE--E-AIDKLWEAIFRITR-IDHD--DPIAAWR
  126 RNCWSLISVPTPAWAQKVFGD-LR--DE--E-AIDKLWEAIFRITR-IDQD--DPIAAWR
  127 RNCWSIISVPTAAWAQKVFSD-LS--QE--E-AINQLWETIFRIVR-VDQD--DPIAAWR
  128 RNCWSIISVPTAAWAQKVFSD-LS--QE--E-AINQLWETIFRIVR-VDQD--DPIAAWR
  129 KNCWSLISVPTLAWAQKIFPN-AS--EE--E-AISKLWDAIFRVTR-VDTD--DPIQAWQ
  130 KNCWSLISVPTLAWAQKIFPN-AS--EE--E-AISKLWDAIFRVTR-VDTD--DPIQAWQ
  131 KNCWSLISVPTPAWAKKIFPD-LS--EE--E-AIDKLWEAIFRITR-VDQD--DPIQAWQ
  132 HNCWSLIAVPTPAWAKKVFPH-MN--ED--E-AIAKLWDVIFQVTR-VDQD--DPIAAWK
  133 RASWTLMAYATPEWALKIFPD-LS--PE--A-ALDALWERIFEATR-VNAD--DPVEAWK
  134 KTTWSIVAYPQKAWAEKVFPE-LS--SE--Q-AQDKLWEQIFQITR-IDQE--DPIEAWN
  135 RITWSIISIPTGDWAQKVFPD-KS--RE--N-AVASLWDAIVKIVR-VDQA--DPIAAWD
  136 KITWSIISIPTGDWAQKIFPD-KS--RE--D-AIASLWEAIIKIVR-VDQE--DPIKAWD
  137 KIPWTIISIPSKAWAKKIFPN-KS--EA--E-AVESLWEAILKIVR-VDQE--DPVAAWD
  138 RLQWSIVSIPIPAWAQKIFPG-ES--EE--T-AQDKLWEQIFSIVR-VDQK--DPIAAWE
  139 RFSWTIVSVPSAAWASKVFPE-AN--EE--E-AIRSLWERIVQAAR-ADRD--RPVEAWR
  140 RMTWSIVAAPSDNWAKLVFPA-LD--TH--A-AVEALWEAIFRAVR-VKLD--DPVHAWA
  141 KFTWSLATAPSAAWAAKVFPD-LP--QE--E-QVAKLWDTIFQMVR-ADQP--DPIAAWE
  142 LIAWSIIAVPSSKWAAKVFPQ-LT--AD--E-QVPALWDAIFKTVH-IGEG--NAVNNWH
  143 LIAWSIIAVPSPKWAAKVFPQ-LT--AD--E-QVPALWEAIFKTVH-IGEG--NAVENWH
  144 LIAWSIVAVPSAKWAAKVFPQ-LT--EE--Q-QVPALWEAIFKTVH-IGEG--NAVDNWR
  145 SIAWSMVAVPSPKWASKVFPD-LA--AE--D-QVPALWEAIFKAVR-IGEG--SAIEKWR
  146 SVAWSMVAVPSPKWASKVFPD-LA--AE--D-QVPALWEAIFKAVR-IGEG--NAIEKWR
  147 SVAWSMVAVPSPKWASKVFPD-LA--AE--D-QVPALWEAIFKAVR-IGEG--SAIEKWR
  148 SVAWSMVAVPSPKWASKVFPD-LA--AE--D-QVPALWEAIFKAVR-IGEG--SAIEKWR
  149 SIAWSMVAVPSPKWASKVFPG-LA--TE--D-QVPALWEAIFKAVR-IGDG--SAIEKWR
  150 SIAWSMVAVPSPKWASKVFPG-LA--TE--D-QVPALWEAIFKAVR-IGDG--SAIEKWR
  151 SIAWSMVAVPSPKWASKVFPG-LA--TE--D-QVPALWEAIFKAVR-IGDG--SAIEKWR
  152 DIAWSIIAVPSPKWAAKVFPD-LP--EK--E-QVPALWDAIFKTVR-IGEG--DAVGNWQ
  153 KVAWSIVAIPSPKWAQKVFPQ-LP--AD--Q-QMEALWQAIFKTVR-IGEG--NAVEAWK
  154 KFSWCLVKAPTRAWAAKVFPE-LP--EE--E-RVRVMWDTIFKMNR-VDAE--DPVAAWK
  155 KFSWCLVKAPTKAWADKVFAD-LP--ED--E-RVSVMWETIFKMNR-VDKD--DPVAAWK
  156 KISWSLIKAPTRAWANKVFPD-LP--EE--E-RIQAMWDAVFLMNR-VGSE--DPVAAWR
  157 KISWSLIKAPTRAWANKVFPD-LP--EE--E-RIQAMWDAVFLMNR-VGSE--DPVAAWR
  158 KISWSLIKAPTRAWANKVFAD-LP--EE--E-RVPAMWEAVFQMTR-VGND--DPVAAWR
  159 KISWSLIKAPTRAWADKVYAD-LP--EE--E-RIPAMWDAVFRMNR-VYSD--NPVAAWR
  160 KISWCLIKAPTKAWADKVFAD-VA--EE--D-RIRVMWDTIFQMNR-VDGS--DPIQNWQ
  161 KISWCLIKAPTKAWADKVFAD-VA--EE--D-RIRVMWETIFQMNR-VDGS--DPIRNWQ
  162 KISWCLIKAPTKAWADRVFAD-VA--EE--D-RIRVMWDTIFRMNR-VDGS--DPVQNWQ
  163 KISWCLIKAPTKAWADKVFAD-VA--EE--D-RIRVMWDTIFQMNR-VDGS--DPIQNWQ
  164 KCKWSIVSVPTKDWAKKVFPN-LS--ED--K-AIEKLWDAIFKCSR-VDGQ--DPIKAWE
  165 KCRWSIVSIPTAAWAKKIFPD-VS--EQ--E-AMDKLWDLIFKCSR-V-TD--DPIEAWK
  166 RCKWSIVACPSVNWAKKVYPN-CS--EE--E-AVEKLWEGIFQCTR-ADLE--SPVDAWN
  167 KVKWSIVAVPSLKWAKRIHPD-LD--DE--Y-AVRELWENILDCSR-V-SE--DPIGDWA
  168 RVKWSIVAVPSLAWAKRVHPN-LA--EN--E-AVEELWKNILDCSR-V-TE--DPVAAWK
  169 RVSWTILIYPTVEWAKKLFP--GK--IR--ELAVADLWEVIFKMTR-VDRE--DPIDAWE
  170 ETQWSIVAYPTKAWAKKIFPD-KN--TE--E-AQTLLMEEILRISR-VSGN-EDPIEAWN
  171 KVSWTVVAAAGQDWAQKVFPD-AT--PE--E-AQDLLWDQIFKTTR-IYEE--DPVAAWK
  172 KVSWTVVAAAGQDWAQKVFPD-AT--PE--E-AQDLLWDQIFKTTR-IYEE--DPVAAWK
  173 KVSWTVVAAAGQDWAQKVFPD-AS--PE--E-AQDKLWDQIFKTTR-IYEE--DPVAAWK
  174 KVSWTVVAAASEGWAAKVFPELAT--SE--E-QVDALWNEIFKTTR-IYEE--NPVIAWN
  175 KVSWTVVAAASEGWAAKVFPELAT--SE--E-QVDALWNEIFKTTR-IYEE--NPVIAWD
  176 KVSWTVVAAASEGWAAKVFPELAT--SE--E-QVDALWNEIFKTTR-IYEE--NPVIAWD
  177 KVSWTVVAAASEGWAAKVFPELAT--SE--E-QVDALWNEIFKTTR-IYEE--NPVIAWD
  178 KVSWTVVAAASEGWAAKVFPELAT--SE--E-QVDALWNEIFKTTR-IYEE--NPVIAWD
  179 KVSWTVVAAAGKQWAAKVFPE-LP--EE--K-QVEALWDQIFKTTR-VYEE--DPVLAWK
  180 QVSWTVVAAAGENWAQKVFPD-LT--KE--Q-AVDALWNEIFKTAR-VDHE--DPVAAWK
  181 KISWTVVAAASVEWAQRVFPD-KS--PE--K-AQEALWDQIFQTTR-VYEN--NPVEAWK
  182 KVSWTVAAAAGAKWAAKVFPDLPT--EE--E-QVDALWDAIFKAVS-LYDA--DPVESWA
  183 KVSWTVAAAAGAKWAAKVFPDLTT--EE--E-QVDALWDAIFKAVN-LYDA--DPVESWA
  184 KISWTLGAAASPEWAAKVFPDLET--EE--E-QVDALWDAIFKAIH-LYDE--DPVATWA
  185 KVSWTVVAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  186 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEA--DPVKAWE
  187 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  188 KVSWTVAAAAGLEWAKKVFPNATS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  189 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  190 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEA--DPVKAWE
  191 KVSWTVAAAAGLEWAKKVFPNATN--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  192 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  193 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEA--NPVKAWE
  194 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  195 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDFLWDQIFKTCR-VYEA--DPVKAWE
  196 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDFLWDQIFKTCR-VYEA--DPVKAWE
  197 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYED--DPVKAWE
  198 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-IYEE--DPVKAWE
  199 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  200 -------------WAKKVFPNAAS--DE--E-AVDFLWDQIFKTCR-VYEA--DPVKAWE
  201 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  202 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  203 KVSWTVAAAAGLEWAKKVFPNATS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  204 KVSWTVAAAAGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  205 KVSWTVAAAAGLEWAKKVFPNATS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVKAWE
  206 KVSWTVAAAAGTEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYEN--DPVAAWQ
  207 KVSWTVAAAAGTEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYED--DPVAAWK
  208 KVSWTVAAAAGTEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYED--DPVAAWK
  209 KVSWTVAAAAGTEWAKKVFPNADS--DE--E-AVDLLWDQIFKTCR-VYED--DPVAAWK
  210 KVSWTVAAAAGTEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-VYED--DPVAAWK
  211 KVSWTVAAAAGTEWAKKVFPDAVS--DE--E-AVDLLWDQIFKTCR-VYED--DPVAAWQ
  212 KVSWTVAAAAGKEWAKKVFPDASS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVRAWK
  213 KVSWTVAAAAGKEWAKKVFPDASS--DE--E-AVDLLWDQIFKTCR-VYEE--NPVRAWK
  214 KVSWTVAAAAGKEWAKKVFPDASS--DE--E-AVDLLWDQIFKTCR-VYEE--DPVHAWK
  215 KVSWTVAAAAGKEWAKKVFPNASS--DE--E-AVDLLWNQIFKTCR-VYEK--DPVRAWK
  216 KVSWTVAAAAGKEWAKKVFPNASS--DE--E-AVDLLWNQIFKTCR-VYEK--DPVRAWK
  217 KISWTLGAASGLEWAKKVFPNAAS--DE--E-AVDLLWDQIFKTCR-IYEE--DPIKAWE
  218 KISWTVAAAAGSAWAKKVFPEATS--TE--E-AVDLLWNQIFTTCR-VYAD--DPVAAWK
  219 KISWTVAAAAGSAWAKKVFPEATS--TE--E-AVDLLWNQIFTTCR-VYAD--DPVAAWK
  220 DIKWTVAAAAGAGWAKAVFPDLET--EE--A-QVDALWDQIFKTCR-VYAD--DPVAAWE
  221 KFSWNLVAASSPEWAAMVFPDLAT--EE--E-QVDALWDAIFKMNR-IYEE--DPIKAWD
  222 KFSWNLVAAPSPEWAAMVFPDLAT--EE--E-QVDALWDAIFKMNR-IYEE--DPIKAWD
  223 KFSWNLVSASSPEWAKMVFPDLAT--EE--E-QVDALWDAIFKMNR-IYEE--DPIKAWD
  224 ----------------MVFPDLAT--EE--E-QVDALWDAIFKMNR-IYEE--DPIKAWD
  225 KVSWNLVAAASPEWAARVFPDLAS--EE--E-QVDALWDAIFKMNR-IYEE--DPIKAWD
  226 KVSWNLVAASSPEWAAMVFPDLDS--QE--E-QVDALWDAIFKMNR-IYEE--DPIKAWD
  227 KFSWNLVAAASPEWAAMVFPDLET--EE--E-QVDALWDAIFKMNR-IYED--DPIKSWD
  228 KVSWNLAAAASPEWAAMVFPNLTS--EE--E-QVDALWDAIFKMNR-IYEA--DPVKAWD
  229 KVSWNLVSAASPSWAKMVFPHLKT--EE--E-QVDALWDAIFKMNR-IYEE--NPIKAWD
  230 KVSWNVAAAAGREWAALVFPELKT--SD--Q-QVDALWDTIFKLNR-IYED--DPIAAWD
  231 KVSWLVVAGASQEWAALVFPD-KS--PE--D-QIDALWDQIFKTTR-IYEA--DPIKAWE
  232 VVSWTVAAAAGQAWAQLVFPD-KS--PE--D-ALDALWDQIFKSTR-VYEE--DPIKAWD
  233 EVSWLVAAGAAPAWAAVVFPDLGS--SQ--E-QVDALWEAIFKANR-IYAD--DPIAAWD
  234 QVKWTVATAADYGWAKHVFPELAD--DK--QAATDALWDAIFKASR-VYEA--DPVEAWN
  235 DLSWTV--------------------GD--A-AVDKLWEEIFKTTR-IDQE--DPIAAWK
  236 DLSWTVVGAAGVKWAEKVFPD-LK--GD--A-AVDKLWEEIFKTTR-IDQE--DPIAAWK
  237 DLTWTVVAASDVAWAKKVFPD-LS--DT--E-AVDRLWEEIFKTCR-IDQK--DPIKAWQ
  238 DLSWTVVSAADQAWAEKVFPE-KK--GQ--A-AIDALWEEIFKTTR-IDKS--DPVKAWH
  239 DLTWTVVGAADTAWAKQVFPD-LS--DD--E-AVDKLWREIFKTAR-VDND--DPIQAWK
  240 KLAWTVVGAASPAWAKQVFPE-LD--EK--A-ATERLWKKIFDTAR-V-TE--DPVKEWE
  241 SISWTIIGAASPRWAQKVFPDAAT--PE--E-ATELLWEAIFKTTR-IDQP--DPEAAWK
  242 SISWTIIGAASPAWAQKVFPDAKT--PQ--E-ATDRLWEAIFKTTR-IDQP--DPEAAWK
  243 KISWTIIGAASPKWAEKVFPDAET--PE--E-ATDKLWTAIFKTTR-IDQP--DPEAAWK
  244 KISWTIIGAASQKWAEKVFPDAKT--PE--E-ATDKLWAAIFKTTR-IDQP--DPEAAWK
  245 KISWTIIGTASPKWAEKVFPDAKT--PE--E-ATDKLWAAIFKTTR-IDQP--DPEAAWK
  246 KNSWIVIAAASPAWAKKVFPD-MD--EQ--A-ATDKLWTEIFKTTR-VDKE--DPILAWE
  247 KNSWIVVAAASPAWAHKVFPD-LE--AQ--E-ATDKLWTEIFKTTR-VDQP--DPILAWE
  248 RFSWTVVAAAGVDWAHHVFPD-LP--PN--V-AVTKLWQLIFKITR-IDQP--DPIAAWQ
  249 DVAWLVVSAAGKEWSQKVFPD-AT--SD--E-AQDKLWQEIFKINR-IALD-NDVIADWQ
  250 DVAWLVVSAAGKEWSQKVFPD-VP--AD--E-AQDKLWQEIFKINH-ISED-NDVIADWQ
  251 DVSWLVVAAAGEAWAEKVFPD-LK--GE--A-ATDRLWEEIFKITR-VGVA-NDVIADWM
  252 DLSWVVVAASSPKWAHKVFPD-ID--IS--E-AVEQLWRKIFEFNR-ITLD-NDPVVAWQ
  253 ---------AGQAWAEKVFPD-LK--GQ--A-AVERLWEEILKDVR-VDDD-SDAIANWT
  254 DISWLVVAAAGQAWAEKVFPD-LK--GQ--A-AVERLWEEILKDVR-VDDD-SDAIANWT
  255 DISWLVVAAAGQAWAEKVFPD-LK--GE--E-AVNRLWAEILKDVR-VDDE-TDAIANWD
  256 DISWLVVAAAGQKWAEKVFPN-LD--GT--D-AVERLWEEILKDVR-VDET-SDALENWT
  257 DISWLVVAAAGQKWAEKVFPN-LD--GT--D-AVERLWEEILKDVR-VDET-SDALENWT
  258 DISWIVVAAAGQEWAEKVFPD-LK--GQ--D-AVNRLWEEILKDVR-IDDD-GDAVDNWD
  259 DISWLVVAAAGQAWAEKVFPD-LS--GQ--A-AVNRLWEEILKDVR-IDDT-SDAIDNWN
  260 DISWLVVAAASPAWAQKVFPN-TD--PA--E-AQQRLWEAIFKTVR-IDDH-SDALENWD
  261 VISWLVVAAPSIAWAEKVFPD-LH--GQ--E-AAERLWQEILKTVR-ISED-NDPIAEWD
  262 DISWLVVAAADVEWAELVYPN-LK--GM--E-AVNCLWREIFKTTL-VDRP--DPIIAWK
  263 DISWLVVAAADLKWAELVFPE-LK--GD--E-AVQALWQAIFKTTL-VDQA--DPVAAWQ
  264 INSWTIASYPSADWAKLVFPDEAN--TD--I-AQEKLLDAILKTVR-VDKD--DPVKAWE
  265 INSWTIASYPSADWAKLVFPDEAN--TD--I-AQEKLLDAILKTVR-VDKA--DPVKAWE
  266 ANSWTLASYPSADWAKLVFPEEKD--SE--K-AQEKLLDAILKTVR-VDRE--DPVKAWE
  267 QFSWTVAAYPSTAWAKLVFPE-LD--ET--A-AFEKLLDAILDSVR-MNSE--DPEAAWA
  268 QFPWVVAAFPTKDWARRVYPD-MD--EE--K-TYEKFIDEVFDIVR-VDGN--DPIQNWD
  269 QFPWVVAAFPTKDWARRVYPD-MD--EE--K-AYEKFIDEVFDIVR-VDGN--DPIQNWD
  270 QFPWVVAAFPTRDWARRVYPD-LD--EE--E-AYEKFIDEVFDIVR-VDGN--DPIENWN
  271 --------FPTRDWARRVYPE-LD--VE--S-AYIKFIDEVFDIVR-VDGQ--NPIENWE
  272 QFPWVVAAFPTRDWARRVYPE-LD--VE--S-AYIKFIDEVFDIVR-VDGQ--NPIENWE
  273 QFPWVVAAFPTRDWARRVYPE-LD--VE--S-AYIKFIDEVFDIVR-VDGQ--NPIENWE
  274 AFPWVVAAFPSKAWAKRVYPN-LP--EE--E-AYSQFIDEVFEIVR-VDGN--DPITNWE
  275 QFPWVVAAFPSKAWAQRVYPN-KS--VE--D-AYSTFVDEVFDIVR-VDGN--DPIQNWK
  276 QFPWVVAAFPSKAWAQRVYPN-KS--VE--D-AYSTFIDEVFDIVR-VDGN--DPIQNWK
  277 RFPWVVAAFPSKDWARRVYPD-LD--EE--I-ALEKFIDEVFDIVR-IDGN--DPIENWK
  278 QFPWVVAAFPSKAWAKRVYPE-LS--VE--E-AYIKFIDEVFDIVR-IDGN--DPVENWR
  279 QFPWVVAAFPSKAWAKRVYPE-LS--VE--E-AYIKFIDEVFDIVR-IDGN--DPVENWR
  280 QFPWVVAAFPSKAWAKRVYPE-LS--VE--E-AYIKFIDEVFDIVR-IDGN--DPVENWR
  281 QFPWVVAAFPSKAWAKRVYPE-LS--VE--E-AYIKFIDEVFDIVR-IDGN--DPVENWR
  282 QFPWVVAAFPSRAWAQRVYPE-LP--VE--E-AYTKFIDEVFEIVR-IDGN--DPVENWR
  283 QFPWVVAAFPSKAWAHRVYPD-LS--IE--E-AYNKFIDEVFDIVR-IDGN--DPIKNWQ
  284 AFPWVVAAFPSKAWAHRVYPD-LP--VE--E-AYSKFIDEVFEIVR-VDGQ--DPIENWQ
  285 QFPWCVAAYPSKSWAKRVYPE-LS--ET--D-AYCKFIDEVLDIVR-VDGN--DPVTNWQ
  286 QFPWCVAAFPSKAWAQRVYPD-LT--ET--E-AYSKFIDEVLDIVR-VDGN--DPVENWK
  287 EFPWCVAAFPSKAWAQRVYLE-LS--TE--E-AFEKFIDEVFDIVR-VDGN--DPVQNWK
  288 DFPWCVVVYPNKPWAQRVYPE-LS--EE--E-AYEKFIDELLDIVR-VDGN--NPVENWN
  289 SFPWLVACYPSQAWANRVYPE-LS--DE--E-AMARFLEDILSIVR-VDGN--DPIENWE
  290 ITSWTIISAPTERWAKKVFPN-----SE--N-PVDDLWEAIFETTR-VNKE--NPIESWN
  291 INSWTVVSVPTEAWAKKVFPD-----SE--N-PVDDLWEAIFKTTR-VDLE--DPVKAWE
  292 ---------------------------E--N-PVDDLWEAIFKTTR-VDLE--DPVKAWE
  293 INSWCVVAAPSVGWAKRVFPE-LS--EE--E-AVEKLWDQIFKATR-SDTE--DPIKAWD
  294 ------------------------------------------------------------
  295 INSWCVVAAPSVGWAKRVFPE-LS--EE--E-AVEKLWDQIFKATR-SDTE--DPIKAWD
  296 RNSWCVVGAATPAWAKVVFPE-LT--EK--E-AVEKLWELIFYTSR-IGEG--DSIKGWE
  297 KNSWCVVGAPTPAWAKVVFPN-LS--EG--D-AVEKLWDLIFYTSR-IGEG--DSIKDWE
  298 KNSWCVVGAPTPAWAKVVFPE-LT--EK--E-AVEKLWELIFYTTR-IGEG--DSIKGWK
  299 QHQWCVAGVAVKSWAKHLFPE-LS--DD--Q-ALEKLWEQIFSTSR-VDDH---TLENWE
  300 ECSWCVVGVAVPSWAKVVFPN-LS--EE--E-AVKKLWDTIFYTVR-VTED--NPISAWE
  301 ETSWIVVGAPTVEWAKSVYPE-LS--DD--E-AVEKLWDAIFKTTR-VDLE--EPEKAWE
  302 NNSWCVIGASVPKWADMVFPN-----DE--D-AVDKLWEKILEVSR-ISSG--DPIANWD
  303 YTSWCVIGAATKAWAAKVFPD-LD--ED--E-AKLKLWEEIFYTVR-LFDD--DPVESMN
  304 YTSWCVIGAATKAWATKVFPD-LD--ED--E-AKLKLWEEIFYTVR-LFDD--DPVESMN
  305 YVSWIVVGASIPSWATKVFPD-LE--EG--E-AVRRLWFEIFNSVR-LFEE--DPIKALE
  306 ECPWCVVSASTVGWAKRLFPE-LT--DE--E-AYLKLWDQILSACR-AKGE--DPVADWE
  307 ECPWCVVSASTVGWAKRLYPE-LS--DE--E-AYLKLWDQILSACR-STGD--DPVAEWE
  308 ECPWSVVAASTVGWAKRLFPE-LD--DE--A-AYLRLWDEILSACR-ADGD--DPVAAWE
  309 IVSWLVISVPTKKWAKKVFPD-LT--EK--E-AYDKLWEVILDVSR-VSESWQETKANWT
  310 ILSWLVISVPTKKWAKKVFPD-LS--EE--K-AYDKLWETILDVSR-VSESWDETKANWT
  311 IVSWLVISVPSVKWAEKVFPD-LK--GE--E-ACQRLWEVILDVCR-VSDSWEETKKNWE
  312 MVSWLVIAYPTKKWAKKIFPD-LP--EE--K-AVDKLWEVIFDVSR-VDEDWEKTKKNWN
  313 MVSWLVIAYPTKKWAKKIFPD-LD--EE--K-AVDKLWEVIFDVSR-VDEDWGKTKKNWN
  314 MVSWLVIAYPTKKWAKKIFPD-LD--EE--K-AVDKLWQVIFDVSR-VDEDWEKTKKNWN
  315 RYRWTLASAPTQAWADAVHPE-LP--RE--D-RLEALWRDILQASR-ATGE--DPIADWE
  316 EYAWSLMSAPTQAWADKVFPE-LP--PE--Q-RLDALWNDILICSR-ADGP--DPVGAWR
  317 KTQWCIVAAPNREWANLVFPE-FE-GEE--A-AVEELWDRILSAVH-VEAE-NDPIQEWI
  318 KTQWCIVAAPNREWANLVFPE-FE-GEE--A-AVEELWDRILSAVH-VEAE-NDPIQEWI
  319 KTQWCIVAAPNREWANLVFPE-FE-GEE--A-AVEELWDRILSAVH-VEAE-NDPIQEWI
  320 KTQWCIVAAPNREWANLVFPE-FE-GEE--A-AVEELWDRILSAVH-VEAE-NDPIQEWI
  321 KTQWCIVAVPNKEWAELVFPE-FE-GSD--A-AVDELWDRILQAVH-VEEH-NDPIQEWS
  322 KTQWSIIAVPNKAWAMEVFPE-FEDAEN--E-AVEELWERILHAVH-VRED-NDPIAEWD
  323 KTQWSIIAVPNKAWAMEVFPE-FEDAEN--E-AVEELWERILHAVH-VRED-NDPIAEWD
  324 KTQWCIAAVPNKQWAMQVFPN-CK-DEE--E-AVELLWKHILAAVY-VDGE-KDPIELWT
  325 LGQWSIVAIPNPEWALKVFPQ-EQ--PD--T-AVEKLWDAILASVR-IQDQ-QDPIPLWE
  326 EGQWCVIGIPSVEWAKVVFPN-LS--EE--K-AFEKLEDAIFMTSR-VTED-SDPLENWR
  327 IGQWSIVALPSQDWAELVFPK-LN--PK--E-AYDALEKAIFSASR-VDEN-SDPEQNWR
  328 RGQWSLVSLPTKEWAHVVFPD-LE--IE--E-AYEKLLEAILYAVR-INES-DDPVEAWE
  329 KSQWTIVAASNPSWAKKLFPN-LQ--VE--N-GIEKLWDAIFNACR-VRID-NDPVQDWV
  330 EISWCVVAYPTRKWAKKVLGE---------E-NTEKLLEYILKASR-IEG---DPVKNWQ
  331 EISWCVVAYPSKKWAKKVIGE---------E-DTEKLLSYILKASR-IEG---NPIENWK
  332 KVSWSVVAVPNEKWAKKVFPE-----ST--N-PVEDLWNAILKTIR-VNEN-DDPVELWN
  333 KNRWCVAGVPNPEWAKKVYGT---------E-DITHLWKDILFMAR-IDES---GYDKLL
  334 KNRWCVAGVPNPEWAQKVYGE---------N-DTEKLWNDILYMAR-IDEN---GYSKLL
  335 SSNWCVVSVPSIPWAKSVYKD-EK--DS--E-AVSKLWDSIFEINR-INTA--DPIQAWK
  336 KVTWLVAAVPSHKWASILFPE-KS--PT--E-AYAALEEAILKASR-SDGP--APLDAWD
  337 --TWLVAAVPSLVWAKLLFPD-DT--EA--D-AFHKLETAILKSAR-ADGP--HPLHDWD
  338 KTNWLVAAVPSTVWARLLYPE-LP--EQ--E-GMDRLWIQLLDAAR-CLGE--DPLADWD
  339 KTTWLVAAVPSAIWAKLLYPD-LD--AD--A-AYEALWKQILQSSR-ADGA--DALADWD
  340 QVPWLIAAVPGKEWAQLLFP--AA--GT--K-AIELLWQKILSAAR-ANGE--NPLADWD
  341 QVPWLIAAVPGKEWAQLLFP--AA--GT--K-AIELLWQKILSAAR-ANGE--NPLADWD
  342 SVTWCVASVPTVLWADLLGYE-GT--DE--E-KIEQLWATLLKLCR-IEGV--EPKDTYR
  343 SVTWCVASVPTVLWADLLGYE-GT--DE--E-KIDQLWATLLKLCR-IEGV--EPKDTYR
  344 SVTWCVASVPTVLWADLLGYK-GT--DE--E-KINQLWDTLLKLCR-IEGV--EPKDTYR
  345 SVTWCVASVPTVLWADSLGYE-GT--DE--E-KIDQLWATLLKLCR-IEGI--EAKDTYR
  346 SVTWCVASVPTVLWADLLGYE-GT--DE--E-KIDQLWATLLKLCR-IEGI--EAKDTYR
  347 SVTWCVASVPTVLWADLLGYE-GT--DE--E-KIDQLWATLLKLCR-IEGI--EAKDTYR
  348 SVTWCVAAVPTVLWAELLGYE-GS--DE--E-KIDQLWLTLLKLCR-LNDV--EAKETYA
  349 TLTWCVASVATLTWADLLGYE-GT--EE--E-KINRLWNTIFTLCR-MKHV--PEEESFS
  350 HVKWTVAAHPSPAWALSVFPE-LG--EE--A-AIEKLWQKIFEATR-VTCD--DPIKAWQ
  351 HVKWCVAAHPTPAWAKSVFPE-LP--EE--Q-ALTKLWEKVFDATR-VSMD--DPVAAWK
  352 FTKWCIVAMPSAAWAKSVYPD-LE--TT--V-AIEKLWEKVFEATR-VDQE--NPVEAWQ
  353 RVQWSIAALPAEPWAKKMFPE-LD--TA--A-AIEAQWKLIFDTCR-VTGG--DPVGEWQ
  354 KVQWSIVAIPSAAWAGKVFPG-AA--EG--E-AQEMLWDAIFDVCR-VKNG--NVVSEWQ
  355 RVQWCVVAVPAPGWAAKVFPD-LP--VE--Q-AVEKLWEVIFDVCR-VSTG--DPVSAWK
  356 VTNWTIVPFAHPGWARAVFPG-LP--EE--E-AVRRLWEAIFQATR-ADQE--DPIAAWE
  357 VTNWTIVPFAHPGWARAVFPG-LP--EE--E-AVRKLWEAIFQATR-ADQE--DPIAAWE
  358 VTNWTIVPFAHPGWARAVFPG-LP--EE--E-AVRRLWEAIFQATR-ADQE--DPIAAWE
  359 VTNWTIVPFAHPGWAKAVFPH-LP--EE--E-AVKALWEAIFQATR-VDQE--DPVAAWE
  360 VTNWTIVPFAHPGWAKAVFPG-LP--EE--E-AVQRLWQAIFQATR-VDQE--DPVAAWE
  361 VTNWTIVPFAHPGWARAVFPD-LP--EE--E-AVAKLWQAIFQATR-VDRP--DPVAAWE
  362 ATNWSILSFATPGWAKSVFPG-DP--DP--A-A--RLWDAIFEVCR-INEA--DPVAAWH
  363 ATNWSILSFATPGWAKSVFPG-EP--DP--A-A--RLWDAIFEVCR-INEA--DPVAAWH
  364 HINWSIVAYATVDWAKMVFPD-LP--EG--Q-AVEKLWEAIFKASR-LDTD--DPVAAWA
  365 HINWSIVAYPQPAWARAVFPG-LS--EQ--E-AVRKLWEAIFKASR-LDTP--DPVAAWK
  366 QINWTIVSFAAPAWAKTVFPD-LP--EH--E-AVASLWDAIFSASR-IDGP--DPVAAWS
  367 DINWTIVSYASPAWAKAMFPD-DP--ED--I-AVAKLWHAIFAASR-VDTP--DPVAAWQ
  368 ATNWTIVSAATPAWARAVFPN-LP--EE--E-AVARLWDAIFAASR-VDGP--DPVGAWA
  369 ATNWTIVSAATPAWARAVFPG-LP--EE--E-AVARLWDAIFAASR-VDGE--DPVAAWA
  370 STNWTIVSAATKPWARTVFPD-LP--ED--E-AVARLWDAVFAASR-IDGP--DPVAAWG
  371 STNWTIVSAATKPWARTVFPD-LP--ED--E-AVARLWDAVFAASR-IDGP--DPVAAWG
  372 STNWTIVSAATKPWARTVFPD-LP--ED--E-AVARLWDAVFSASR-IDGP--DPVAAWG
  373 STNWTIVSAATKPWARTVFPD-LP--ED--E-AVARLWDAVFSASR-IDGA--DPVAAWG
  374 DVNWNIVAYPGMAWARLMFPD-DS--AD--G-AVARLADAIFSASR-VDND--DPIANWT
  375 DVNWNIVAYPGEAWARLMFPD-DS--PD--G-AVAKLAEAIFSASR-VDDD--DPVANWT
  376 DINWNIVAYPGTAWATLMFPD-DS--ES--D-AVAKLADAIFSASR-VDND--NPIANWT
  377 DINWNIVAFPSVAWARQMFPD-VA--DD--I-AVAKLADAIFAASR-VDND--DPIANWT
  378 ETNWNIIAYPSASWAKLVFPD-VP--EE--V-AVAKLADAIFAASR-VDRE--DAVSAWE
  379 ETNWNIIAYPSAAWAKLVFPD-VP--EE--V-AVAKLADAIFAASR-VDRE--DAVSAWA
  380 ETNWNIIAYPSASWARLVFPD-VP--EE--V-AVAKLADAIFAASR-VDRE--DAVSAWE
  381 -----------------VFPD-VP--EE--V-AVAKLADAIFAASR-VDRE--DAVSAWE
  382 ETNWNIIAYPSAAWAKLVFPD-VP--EE--V-AVAKLADAIFAASR-VDRE--DAVSAWE
  383 DTNWNIIAFPSPSWAKLVFPD-VP--EE--V-AVAKLADAIFSASR-VDQE--DAVDAWE
  384 DTNWNIIAYPSPSWAKQVFPN-DP--ED--V-AIGKLADAIFAASR-VDRE--DAMANWA
  385 DTNWNIIAYPSAAWAKLVFPN-DQ--EE--V-AIGKLADAIFAASR-VDRE--DATANWA
  386 DINWNIIAYPSPSWAKQVFPN-DP--EE--V-AIGKLADAIFAASR-VDRD--DAPANWA
  387 DTNWNIIAYPSPSWAKQVFPN-DP--EE--V-AIGKLADAIFAASR-VDRD--DAPANWA
  388 DINWNIVAYPDLAWAKQVFPG-DA--DD--V-AVVKLADAIFAASR-VDVE--DPIGNWK
  389 DINWNIVAYPDLAWAKQVFPD-DA--DD--V-AVAKLADAIFAASR-VDVE--DPIGNWK
  390 DINWNIVAYPDLAWARQVFPG-DA--DD--V-AVAKLADAIFAASR-VDVE--DPIGNWT
  391 DINWNIVAYPDLAWAKQVFPH-DA--DD--V-AVAKLADAIFAASR-VDVE--DPIGNWK
  392 DINWNIVAFPDLAWAKQVFPD-DA--DD--V-AVAKLADAIFAASR-VDVE--DPIGNWT
  393 DVNWNILAYPSAAWAKLVFAE-DA--ED--V-AIGKLAAAIFAASR-VDND--DPVAAWT
  394 DINWNIVSYPNPSWAKVVFPD-DP--EP--I-AIAKLAKAIFAASR-VDVS--DPVAAWA
  395 DINWNIVSYPNPSWAKVVFPD-DP--ET--I-AIAKLAKAIFAASR-VDLD--DPIAAWA
  396 DINWNIVSYPNPSWAKVVFPD-DP--EP--I-AIAKLAKAIFAASR-VDVD--DPIAAWA
  397 DINWNIVSYPNPSWAKLVFPD-DP--EV--I-AVAKLAKAIFSASR-VDVE--DPVAAWA
  398 DINWNIVSYPNPSWAKQMFPD-DP--EA--V-AVEKLANAIFAASR-VDVD--DPIAAWK
  399 DINWNIVSYPNPSWAKQMFPD-DP--EA--V-AVEKLANAIFAASR-VDVG--DPIAAWK
  400 DINWNIVSYPNPSWAKQVFSD-DP--EA--I-AVEKLANAIFAASR-VDVD--DPIAAWA
  401 DINWNIVSYPNPSWAKQVFSD-DP--EA--I-AVEKLANAIFAASR-VDVD--DPIAAWA
  402 DINWNISSYPNPSWAAQVFPD-LP--LD--E-AVKKLADAIFAASR-VDQP--DPVAAWM
  403 DINWNICSYPNPSWAKLVFPD-VP--VE--I-AVAKLADAIFAASR-VDQA--DPVAAWK
  404 DINWNIISYPNPSWAKQVFPG-LT--ED--E-AVRKLADAIFAASR-VDVA--DPVAAWS
  405 DINWNIISYPNPSWAKQVFPG-LT--ED--E-AVRKLADAIFAASR-VDVA--DPVAAWA
  406 DINWNIISYPNPSWAKQVFPG-VT--ED--E-AVRKLADAIFAASR-VDLA--DPVAAWA
  407 DINWNIISYPNPSWAKQVFPG-VT--ED--E-AVRKLADAIFAASR-VDLA--DPVAAWA
  408 DINWNIISYPNPAWAQLMFPN-DA--ED--V-ATRKLAEAIFAASR-VDVD--DPVGAWA
  409 DINWNIVSYPNPAWAKLMFPN-EP--AD--I-ATRKLADAIFAASR-VDVD--DPVGAWA
  410 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  411 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  412 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  413 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  414 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  415 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  416 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  417 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  418 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  419 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  420 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDEE--DPIGAWA
  421 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  422 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  423 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPIGAWA
  424 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDEE--DPIGAWA
  425 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPVGAWA
  426 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPVGAWA
  427 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPVGAWA
  428 DINWNIVSYPNPDWAMLVFPG-EP--EE--V-ATRKLAEAIFAASR-VDVE--DPVGAWA
  429 DINWSIVSYPNPAWAKLVFPD-LP--ED--E-AIVALAKAIFAASR-VDQP--DPVAAWN
  430 EINWNIVSYPNPKWAKLVFPD-LG--ED--E-AVAKLADAIFAASR-VDQA--DPVAAWK
  431 AINWSIIAYPTAGWATAMFPD-LP--LE--Q-AIQKLAGAIFSASR-VTQD--NAVDAWH
  432 AINWSIIAYPTAGWATAMFPD-LP--LE--Q-AIQKLAGAIFSASR-VTQD--NAVDAWH
  433 AINWSIIAYPTAGWATAMFPD-LP--LG--E-AIQKLAEAIFSASR-VTQD--NAVYAWH
  434 TINWSIIAYPTPEWAIAMFSD-LP--LD--K-AVQKLAEAIFSASR-VTQD--NAVYEWH
  435 AINWSIIAYPTVGWAKTMFPD-LP--VD--E-AVKKLADAIFSASR-IIEN--DAVHAWN
  436 SINWSIVAYPTAGWVEAMFPS-LP--LN--E-AIKKLADAIFSASR-VTEE--DPVHAWV
  437 AMNWSIVAYPTAGWAEAMFPS-LP--LN--E-AIKKLADAIFSASR-VTGE--DPVQAWT
  438 AVNWSVVAYPTAGWAEAMFPS-LP--FN--E-GIKKLADAIFSASR-VTQE--DPVHAWV
  439 AMNWSIVAYPTAGWAATIFPA-LP--IN--E-AIKKLADAIFSASR-VTGE--DPVHAWG
  440 EINWSICAWPGQAWAQRMFPD-LA--PS--E-AQAKLAEAIFAASR-VDRD--DPVAAWA
  441 EINWSICAWPGQAWAQRMFPD-LA--PS--E-AQAKLAEAIFAASR-VDRD--DPVAAWA
  442 EINWSICSWPGLSWARRMFPD-LP--GA--Q-AQARLAKAIFAASR-VDRD--DPVAAWA
  443 AINWSIASYPSPSWARRMFPD-LP--ED--Q-AVDRLAQAIFAASR-VDAS--DPVAAWQ
  444 AINWTLVPFANPAWARAVFPD-VA--EE--V-AVAKLWEALFAATR-ADRP--DPEAAWA
  445 AINWTLVPFASAAWARAVFPD-AS--PE--Q-AVEQLWNALYASTR-VDQA--DPKAAWA
  446 EVNWNIVAYPGAAWAAKVYPD-LP--VA--E-AQGKLMDAIYAASR-LDGD--DPVANWA
  447 EVNWNIVAFPGAGWAARVFPD-LP--VE--Q-AQGKLMDAIYTASR-LDGD--DPVANWA
  448 AINWNIVAFATPAWAQQVFPD-LS--VD--A-AVSRLWDAIFQASR-VMVN--DPVAEWE
  449 AINWNIVAFATPAWAAQVFPD-LS--AD--A-AVSRLWDAIFQASR-VMVD--DPVAEWK
  450 AINWNIVAFATPAWAAQVFPD-LP--EK--E-AVSRLWDAIFQASR-VMVD--DPVAEWE
  451 AINWNIVAFATPAWAAQVFPD-MP--ED--E-AVSRLWDAIFQASR-VMVD--DPVAEWE
  452 AINWNIVACATPTWAQQVFPD-LP--PE--Q-ALARLWDAIFTASR-VTTA--DPVAEWA
  453 AVNWNIVACATPAWAAQVFPD-DA--PD--R-ALARLWDAIFLASR-VTVD--DPVAAWV
  454 AVNWNIIACATPAWAAQVFPE-LP--AD--E-ALAALWDGIFKASR-VDVA--DPVAEWK
  455 AVNWNIIACATPAWARQVFPD-LS--EA--E-ALEALWNGIFKSSR-VDVA--DPVGEWK
  456 DVNWCIVAAASPAWAAQVFPD-LP--VD--Q-AVEKLWQAIFSVSR-ITGE--NPVADWE
  457 DVNWCIVAAASPAWAAQVFPD-LP--VD--Q-AVEKLWQAIFSVSR-ITGE--NPVADWE
  458 DVNWCIVAAASPAWAAQVFPD-LP--VD--Q-AVEKLWQAIFSVSR-ITGE--NPVADWE
  459 DVNWNIVATATPAWAKLVFPG-LP--ED--E-AVARLWQAIFESSR-LTGA--DPVADWA
  460 DVNWNIIAWPGTQWAKRVFPK-MS--ED--E-AQLALADAIFDASR-VKVA--DPIQAWR
  461 AINWTIVPAATPDWAKLVFPD-LP--AD--Q-ALARLWDAIFAATR-VDRE--DPVAAWK
  462 EINWTIVAAATPSWAATMFPN-DS--AD--V-AINKLWDAIFATSR-VGGD--DPVSLWK
  463 AINWSICAAATSAWSRLVFPG-IP--EE--E-AMLKLWDAIFYASR-ATSE--DPVAAWK
  464 AINWSILAGATPAWAKLVFPD-LP--EA--E-AVSKLWEAIFKASR-IDGD--DPVQDWK
  465 EINWTIVAAATPAWAALVFPN-DP--PE--L-ALGRLWDAIFATSR-ITSA--DPVAQWK
  466 DINWSIIPYPSLAWAKVVYPN-DP--DS--I-ALAKLAKAIFVVSR-SDCA--DPIIAWA
  467 DINWSIVPFPSCAWAEIVYPD-DP--VP--I-AIAKLANTIFSVSR-AHCI--DPIAAWA
  468 DINWSIVPFPSCAWAEIVYPD-DP--VP--I-AIAKLANTIFSVSR-AHCI--DPIAAWA
  469 ATNWCIIGAASPRWAQMVFPD-EP--PQ--R-QMELLWEAIFKVNR-VDQT--DPLAAWQ
  470 RLNWNLISAPIPGWAALMFPD-AS--AE--E-AMDKQWDAIFAATR-ADQP--DGVEQWQ
  471 RLNWNLISAPVPGWATLMFPD-AS--EP--E-AIEKQWDAIFAATR-ADRP--DPVAEWQ
  472 RLNWNLISAPVPEWAELMFPG-LP--RD--E-AVQKQWDAIFAATR-ADQP--DPVAAWQ
  473 RLNWNLVSAPIPGWATLMFPE-AS--SE--Q-AVEQQWDAIFAAVR-ADQP--DPVALWE
  474 LLNWNLVSAPIPAWAQMMFPD-DS--PE--E-AVRKQWDAIFAATR-ADQP--DPVGAWR
  475 AVNWNLITAPLPAWSALIFPD-VS--SE--E-AVDRHWDAIFAATR-ADQP--DPIQAWE
  476 AVNWCVVAAATPAWAAKVFPD-AP--EG--E-RLGRLWDAIFRAVR-ADGP--DPVGTWE
  477 AVNWCVAAMSTLAWAARVYPD-LE--EQ--E-GVARLWDDIFAVTR-ADQP--DPVAAWD
  478 AVNWCVAAMSTPAWASRVYPQ-LS--QD--E-AVARLWNDIFTVTR-ADQP--DPVAAWN
  479 KVNWTVAGMATPAWARRVFPQ-LP--EE--A-AVARLWDDIFKVTR-ADQP--DPVAAWD
  480 AVNWTVAAMSTPAWAQAVYPE-LP--EA--E-AVACLWDDIFKVTR-ADLP--DPLGAWE
  481 TVDWTLGAMSTPAWARSVYPD-LP--EA--E-GVARLWEDIFTVSR-INEA--DPAAAWQ
  482 AVNWSIGAMPVASWARKVFPG-VP--DG--E-AVARLWDAIFTVSR-ADEA--DPVAAWD
  483 KVNWLALGAATPAWARAVFPE-PE--PE--E-ATERLWEAIFATVR-LDRP--DPEAAWR
  484 RVNWCAIPFVTQSWARIVYPS-MP--IA--E-ATDKLWNDVFDVVR-VKSA--DPIAAWR
  485 QVSWTVIVYPTEQWAASIFPD-LE--PK--N-ALEELWEKFFEILK-LSEE--SPLQAWE
  486 RLQWCVAGVPTPAWAQEVFPD-RP--AE--E-AVEALWEAILRMTR-ADQP--DPPAAWN
  487 HAAWCVASVPTMAWAKKVYPE-----SE--D-ALSDLWNAVLKMSR-VNEK--DANENWN
  488 ELNWTVVPAPNAGWAQHVRPG-LD--AG--E-ALRLLEQDIRTVCR-LDED--DPVEAWR
  489 TTNWTVVPCPTREWAQLVHPE-LD--AD--A-AWARLCDQIVHVLR-LDAP--DPTAAWR
  490 ELAWCTVCAPGPKWAAKVLNK-----PECQK-TLEEFFDIQKKIML-LDSE--NPIKAWE
  491 ELAWCIICAPGPKWAAKVLNK-----PESQK-TLEEFFKIQKKIML-LDSK--DPIKAWE
  492 ELAWCTICAPGPKWASKVLNK-----PESQK-TLEEFFKIQKKIML-LDTE--DPIKAWE
  493 -----------------------------------------------LDTE--DPIKAWE
  494 ELAWCTICAPGPKWASKVLNK-----PESQK-TLEEFFEIQKKIML-LDTE--DPIKAWE
  495 EIAWCVVCSPGPKWASKVLNK-----KEGNK-TLEEFFEVQKRILL-LDKE--NPIKEWE
  496 EIAWCVVCSPGPKWASKVLNK-----KDGNK-TLEEFFKIQKRILL-LDRE--NPIKEWE
  497 EIAWCVVCSPGPKWASKVLNK-----KEGNE-TLEEFFKIQREILL-LDRE--NPIKEWE
  498 EIAWCVVCAPGPKWASKVLNK-----KEGSQ-TLEEFFKIQKKILL-LDSE--NPIESWE
  499 EIAWCVVCAPGPKWASKVLNK-----KEGSQ-TLEEFFKIQKKILL-LDSE--NPIESWE
  500 EIAWCVVCAPGPKWASKVLNK-----KEGGQ-TLEEFFKIQKKILL-LDRE--DPIKNWE
  501 EIAWCVICSPGPKWASKVLNK-----KEESK-TLEEFFKIQKKILL-LDNE--NPIEEWE
  502 QHPWCVVAAPGPAWAQRTLGSPAAETPESSVQQLQAFWQQLRSVLR-LDTP--DPVAAWD
  503 QLPWCVCCAPGPRWAKQVLGD---------EATEDDMMEVLKPILL-LDQG--DPIAAWD
  504 QLAWCVCCAPGPLWAKQVLGD---------NATTEDLMDVLTPILL-LDTP--DPALAWE
  505 QLPWCVVCVPGPRWAKQIFGSDDP--------TIDHLWQVIAPIVM-IDKS--DPEDAWD
  506 NIVSCKTVIPTQYWADYLFP------KE--KNALTKLWDLYFDITL-ANLD--DAISLWN
  507 DIVSCKTVIPTKYWAECIFP------EE--LRPLDKLWEVYLQITL-ANFD--NAVEIWN
  508 ELKWVIAPYPTRALAQEAGM------------SISEYEDFVYHATY-ADSA--DPVSVWS
  509 ELKWVVAPYPTRALAQEAGM------------SISEYEDFVYHATY-ADSA--DPVSMWS
  510 ELKWVIAPYPTRALAQEAGM------------SISEYEDFVYHATY-ADTP--DPVSEWS
  511 ELRWAVTAYPTRALAQEAGM------------SIIDYEDFVFHATY-ADTD--DPVKKWV
  512 ELRWTVTAYPTKALAQEAGM------------SIIDYEDFVFHATY-ADTD--DPVKKWV
  513 ELKWVVTIYPTKALAQEAGM------------SISEYEDFVFHALY-ADAE--NPVAEWT
  514 ELRWTLAPYPTRAMAQEAGM------------SILEFEEFVYRATM-VDRD--DPIAAWR
  515 ---WTITVYPTNAMAQEAGF------------SPIEWKNFVYSALK-LYSS--DPIEEWK
  516 DLKWTVAAYPTRAMAQEAGM------------TPLEFEEFVFRAVK-LHTP--DPISTWI
  517 SLRWTVTAYPAPSLAQEAGM------------GLLEFEDFVVRALK-LHED--DPVAAWK
  518 --------YPTMAHAQNAGL------------SLDEYTDFIYTACR-LDAA--DPKAAWE
  519 SLNWNLCQFPTQADAQEAGM------------SLIDYRDFVYKACH-LDKE--DPIAYWK
  520 DLRWNICQYPTLADAQEAKM------------SLEDYEDFVFKACH-LDKE--DPIKYWR
  521 DFSWVIAPYPTSSMAQDAEM------------SFDEYAEFVFGACK-LNES--DPVKSWR
  522 EFKWVLAPYPTPSMAQDAEM------------SFEEYKEFVFNACK-LNYD--DPVKEWQ
  523 EFRWSLCPYPTQAMAQDAEM------------SLDEYTEFVFNACK-LNEA--DPVAAWK
  524 EFRWSLCPYPTAAMAQDAEM------------SLDEYTEFVFRACR-LHED--DPVAAWR
  525 NFRWVLAIYPTNGYAQDAGM------------SLEEYTDFVYNACL-PDMN--DPVGFWK
  526 NFRWVLAIYPTNGYAQDAGM------------SLEEYTDFVYNACL-PDMN--DPVAFWE
  527 NFRWVLAIYPTNGYAQDAGM------------SLEEYTDFVYSACL-PDMN--DPVAFWK
  528 NFRWVLAIYPTNGYAQDAGM------------SLEEYTDFVYSACL-PDMN--DPVAFWK
  529 NFRWVLAIYPTNGYAQDAGM------------SLEEYTDFVYSACL-PDMN--DPVAFWK
  530 AFKWVVAPFPTNAMAQDAEM------------SLEEYEDFVYGACL-PDMA--DPIGYWN
  531 QLRWVSTLFPTQAYAMEAGM------------GWHEYRNFVFSACA-VDGSVPDPVAYWQ
  532 SFKWVTTLFPTEAYAQEANM------------SLSEYSNFVFRACH-ADDE--DPIAYWR
  533 NFRWCLTLYPTTAYAQDTNM------------SLREFEEFVFDVCF-LNDE--DPAARWK
  534 DFRWCVTLFPTEGLAQDANM------------SLPDFEDFVYGVCF-LNEA--DPIAKWQ
  535 G-KYCVTLFPTQALAQEAGM------------SLSDYQEFVFEACR-LNDD--DPVAAWQ
  536 G-KYCVTLFPTQALAQEAGM------------SLSDYEEFVFAACR-LDDD--DPVASWQ
  537 TLNWCVTLFPTNAAAQDADM------------SLSDFEEFVYRACK-LHYN--DPVAEWR
  538 TLNWCVTLFPTNAAAQDADM------------SLSDFEDFVYRACK-LHYD--DPVAEWR
  539 KLAWCVTLYPTEAYAQDAEM------------ALAEYEEFVLRAGF-LDRE--DPVTAWR
  540 KLNWCVTLYPTEAYAQDAEM------------SLAEYEEFVLRACL-LDRE--DPVAAWQ
  541 ELKWCGTLFPTAALAQEADM------------SLRDYTEFVVRAGF-LDDP--DPVARWR
  542 ELRWCLTLYPTHAYAQDAEM------------SLEEYENFVFNAGL-IHHD--NPSESWQ
  543 --RWALTLYPTPGYAQQAGM------------ATGDFRAFVQRALF-LDKP--DPVAAWR
  544 --RWSLTLYPTAGFAQQAGM------------STRAFRRFVERALF-LDHP--DPIAAWR
  545 --RWALTLYPTVGYAVGAGM------------GTEEFRAYLQRALF-LDRE--DPVAAWQ
  546 --RWALTLYPTVGYAVGAGM------------GTEAFRAYMERALF-LDRE--DPVAAWR
  547 --RWTLTLYPTVGYAVGAGM------------GTEEFREYLKGALF-LDRE--DPVGAWR
  548 --RWCLTLYPTAGYAQQAGM------------STTGFRAFVERALY-LDRP--DPIAAWH
  549 --RWCGTLWPTPAGAQQAGM------------GFDGFAAFVRGALF-LDRD--DPAAAWR
  550 --RRTLTLWPTAGLAAMAGM------------SQPAYRRLVRRAFF-LDRP--DPAAAWR
  551 --KWSLTLFPTPYAAMQAGM------------SEAEFGAFVMRAMF-LDRP--DPVAAWG
  552 --KWSLTLFPTLHAAAQANM------------GHEAFGDFVMRAMF-LDRA--DPVAAWG
  553 --KWSLTLYPTPHAAAQAGM------------TLAEFEDFVMRAMF-LDRP--DPVAAWG
  554 --KWSLTLYPTEFAAEQANM------------SLPEFEDFVMRAMF-LDRA--DPVAAWG
  555 --KWTLTQYPALADAQAAGM------------SEEEYAAFVARAMF-LDHA--DPVAQWA
  556 --KWCGTLFPTASGAQDAGM------------SLDDFERFVYDAMF-LFDD--DPTARWL
  557 --RWVLTLFPTDALAQESEM------------GLEEYEDFVFAAMA-LEEE--DPVAFWR
  558 --RWVITQYPTAAYAAEANM------------TLEDYTNYVARSMF-LDQP--DPAEAWR
  559 --RWVLTQYPTLAYANDAGM------------SLADYEAYVTSSMF-LDRP--DPVGAWQ
  560 QLRWCDVLYPTEAFAQDAGM------------SLWDFEDLVVKSYL-LDHP--DPVTAWQ
  561 KMRWSYTMFPTAAAAQDAEM------------GTKAYEEMIFNLGA-LNQE--DPVAHWK
  562 --TWCLTQYPAPANAQLAQT------------STEGYENFVWDAVL-KD---------WD
  563 --TWCLTQYPAPANAQLAQT------------STEGYENFVWDAVL-KD---------WD
  564 --RWCLTQYPAQTNAQLAQL------------STEGYENFVWDAVN-KD---------WD
  565 --RWCLTQFPAPANAQLAEM------------STEGYENFVWDAVN-KD---------WA
  566 --RWCLTQYPAPANAQLAEM------------STEGYENFVWDAVN-KD---------WE
  567 --RWCLTQFPAPANAQLAEM------------STEGYENFVWDAVN-KD---------WD
  568 --RWCLTQFPAPANAQLAGM------------STEAYENFVWDAIN-KD---------WG
  569 --RWCLTQYPTQGNAQLAGM------------STEGYQNFVWDAVN-KD---------WD
  570 --RWTLTQHPTPADAQLAEM------------SFEAYQNFVYDAIL-KD---------WD
  571 --RWTLTQHPTPADAQLAEM------------STEAYENFVYDAIL-KD---------WD
  572 --RWCLTQYPSPGSAQLAEM------------STEAYEEFVYSAMN-KD---------WD
  573 --KWCLTQFPTAGNAQLAGM------------STEGYENFVWDAVN-LD---------WD
  574 --TWCLTQYPTTGNAQLAGM------------STEAYENFVWDAVG-LD---------WN
  575 --RWCLTQYPAKGSAQLAGM------------STEAYENFVYDAVT-LD---------WD
  576 --TWCLTQYPTASHAQLAGM------------STEAYENFVWDAVS-LD---------WD
  577 --TWCLTQHPSSGYAQLAGM------------STEEYEEFVYDAVS-LD---------WD
  578 --KWCLTQYPAPADAQLAGM------------STAAYEDFVYDAVN-KD---------WD
  579 --KWCLTQHPAPADAQLAGM------------STAAYEDFVWSAVN-KD---------WD
  580 --RWCLTQHPTNAYAQAADL------------PLGAYRDFVYGAIL-RD---------WA
  581 --DWVSTLHPTRALAQQAGM------------AFEAYRDFVYDATL-RD---------WE
  582 --DWVSTLHPTRALAQGAGM------------AFEEYREFVYDATL-RD---------WE
  583 --DWVSTQHPTRAMAQQAGL------------SSEAYRDFVYDATL-RD---------WE
  584 --DWVSTQHPTRAMAQQAGM------------AYAEYKDFVYDATL-RD---------WE
  585 --DWVSTQHPTRAMAQQAGM------------AYADYKDFVYDATL-RD---------WE
  586 --DWVKTVHPTRSLAQQANM------------SFAAYQEFVYDAVL-RD---------WE
  587 --DWVGTVHPTRSLAQQANM------------SYEEYQAFAYDAIL-RD---------WE
  588 --RWVSTVHPTQSLAQQANM------------AYEEYQEFAYDAIL-RD---------WE
  589 --CWVSTAHPTRSLAQQANM------------AYEEYQDFAYDAIL-RD---------WE
  590 --RWVSTVHPTRSLAQQANM------------AYEEYQDFAYDAIL-RD---------WE
  591 --RWVSTVHPNRSLAQQANM------------AYEEYQEFAYDAIL-RD---------WE
  592 --RWVSTYHPTRSLAQQAEM------------AYEEYQEFVYDAVL-CD---------WE
  593 --DWVSTVHPTRSLAQQAGM------------AYEEYQQFVYDAVC-RD---------WE
  594 --DWVSTVHPTRAAAQQAGM------------SFEAYADFVYDAIL-RD---------WS
  595 --DWVSTLHPTRAYAQQAGM------------AYEEYQDFVYSAVL-RD---------WK
  596 --DWVSTVHPTRALAQQAGM------------SYTQYQDFVYDAIL-RD---------WE
  597 --RWCLVRIPSVTLAQQGGI------------DEDTLEEMFFDACF-LN---------WP
  598 --RWCLVRIPTSALAQQAGV------------DENTMMEMFFNACLKIN---------WE
  599 --RWALVRVPTAEWADAMGL------------DASAMLREWAAS---FDAD-------WA
  600 --KWVYLRYPTPSMAQLANK------------STEAFEQFYFDVCT-MD---------YA
  601 --RWVVLRYPNPSMAQLAGT------------STEGFEDFFFNVCN-VD---------YG
  602 --KWVVLRYPTPSMAQLANM------------STEAFEDFYFDVCN-LD---------YA
  603 --KWVVLRYPNASMAQLANT------------STEAFEDFYFDVCN-LD---------YS
  604 --RWVVLRYPNASMAQLAGM------------STSKFENFYFDVCN-LD---------YA
  605 --KWCIMRYPNGSMAQLANT------------STDAFEDFYFNVCN-LD---------YS
  606 --RWVVLRYPNKSMAQLSKM------------SLESFEDFYFSVCN-LD---------YA
  607 --KWVVLRYPSPSMSQLANT------------SIENFENFYFNVCN-LD---------YE
  608 --KWVVLRYPSPSMSQLANT------------STEAFEDFYFNVCN-LD---------YS
  609 --KWVVLRYPSPSMAQLANT------------STENFEDYYFDVCN-LD---------YA
  610 --KWCVMRYPTHSMAQLANT------------PTEYFEDFYFKVCN-LD---------YA
  611 --KWCVLRYPNAAMAQLANM------------STEAFEDFYFNVCN-LD---------YA
  612 --KWCVLRYPNASMAQLADT------------STEAFEDFYFKVCC-LD---------YE
  613 --RWCVMRYPNPSMAQLAEM------------STEAFEDLYFQVCN-LD---------YS
  614 --RWCVLRYPNAAMAQLANT------------SIEGFEDFYFNVCN-LD---------YS
  615 --KWVVMRYPNASMSQLANT------------SVEAFEDFYFDVCN-LD---------YA
  616 --KWVVLRYPNDSMAQAANQ------------STDAFETFYFNVCN-LD---------YA
  617 --KWVVLRYPNASMAQLANM------------STAAFEDFYFKVCT-LD---------YG
  618 --KWVVLRYPNPSMAQLANM------------STAAFEDFYFQVCN-LD---------YA
  619 --KWVVLRYPNHSMAQLANM------------STAGFEDFYFNVCN-LD---------YG
  620 --RWVVLRYPSSSMAQLANT------------STEAFEDFYFNVCN-LD---------YS
  621 --KWVVLRYPNSSMAQLAKM------------STEAFEDFYFNVCN-LD---------YG
  622 --KWVVLRYPNPSMAQLAKM------------STEAFEDFYFNVCN-LD---------YG
  623 --KWVVLRYPNDSMAQLAKM------------STEAFEDFYFDVCN-LD---------YG
  624 --KWVVLRYPNASMAQLAKM------------STEGFEDFYFNVCN-LD---------YA
  625 --RWVVLRYPNASMAQLAKM------------STEAFEDFYFEVCN-LD---------YG
  626 --RWVVLRYPNASMAQLAKM------------STEAFEDFYFEVCN-LD---------YG
  627 --RWVVLRYPNASMAQLAKM------------STEAFEDFYFEVCN-LD---------YG
  628 --RWVVLRYPNASMAQLAKM------------STEAFEDFYFEVCN-LD---------YG
  629 --RWVVLRYPNASMAQLAKM------------STEAFEDFYFEVCN-LD---------YG
  630 --KWVVLRYPSASMAQLAKM------------STAGFEDFYFDVCN-LD---------YG
  631 --KWVVLRYPSASMAQLAKM------------STAGFEDFYFDVCN-LD---------YG
  632 --KWVVLRYPSSSMAQLAKM------------STVGFEDFYFDVCN-LD---------YG
  633 --KWVVLRYPSSSMAQLAKM------------STVGFEDFYFDVCN-LD---------YG
  634 --KWVVLRYPSSSMAQLAKM------------STAGFEDFYFDVCN-LD---------YG
  635 --KWVVLRFPTASMAQLANQ------------STEAFEDFYFDVCT-LD---------YA
  636 --KWVVLRYPSPSMAQLAGK------------STEAFEDFYFNVCT-LD---------YG
  637 --KWVVLRYPNASMAQLSGK------------STEAFEDFYFNVCN-LD---------YA
  638 --KWVVLRYPSSSMAQLAKM------------STTGFEDFYFNVCN-LD---------YG
  639 --KWVVLRYPNASMAQLSNT------------SLEAFEDFYFDVCT-LD---------YG
  640 --KWCILRYPNYSMAQQAKM------------SLEEFEDFYFNVCN-LD---------YS
  641 --KWCILRYPNYSMAQQAKM------------SSEEFEDFYFNVCN-LD---------YS
  642 --KWCILRYPNYSMAQQAKM------------SLEEFEDFYFNVCN-LD---------YS
  643 --KWCILRYPNYSMAQQAKM------------SLEEFEDFYFNVCN-LD---------YS
  644 --KWCILRYPNYSMAQQAKM------------SLEEFEDFYFNVCN-LD---------YS
  645 --KWCILRYPNYSMAQQAKM------------SLEEFENFYFNVCN-LD---------YC
  646 --KWCILRYPNYSMAQQARM------------SKEAFEDFYFNVCN-LD---------YR
  647 --KWVVLRYPNASMAQLAGM------------SNEAFTDFYFNVCN-LD---------YS
  648 --KWVVMNYPTPAMAQQASM------------STDEFEDFYFKVCN-LD---------YS
  649 --KWVVMNYPTPAMAQQASM------------STDEFEDFYFKVCN-LD---------YS
  650 --RWVVLRAPTPSMAQLANM------------SEAAFEDFFFNVCT-LD---------YA
  651 --KWVILRYPNGSMAQSAKM------------SKDAFKDYFFDVCC-LD---------YS
  652 --RWCVLRWPNPSMAQGAKM------------STEAFEDFYFKACL-AD---------YP
  653 --KWVILRWPTPAMAQQAMM------------STESFEEFFFRVCT-QD---------YS
  654 --KWVVLRWPSSAMAQQAGL------------STEAFEDFYFRVCT-LD---------YS
  655 --KWCVLRWPTSAMAQQAMM------------STEAFEDFFFKVCN-QD---------YS
  656 --RWCVLRWPSPSMAQSAGM------------STEAFEKFFFDVCT-LN---------YA
  657 --RWVVLRWPSPSMAQAASM------------STEAFENLYFDVCT-MD---------YQ
  658 --KWCVMRYPTPSMAQSANM------------STSAFTDFFFRVCT-TD---------YA
  659 --TGLRINYPTSALAQKANM------------TTDAFEDFYFNVCS-LD---------YR
  660 --RWTLLNYPTTGLAQNANM------------STVAFEDFYFDVCS-VD---------YK
  661 --KWVVLRYPTPTMAYQAAM------------STEAFEDFYYRVSVGVD---------YA
  662 --KWVVARFPTEIMAMQAGK------------STREFEDFFYKVTTEVD---------YE
  663 --RWCGLRWPSGGMAQQAAM------------STEEFEDFYFRTCL-MD---------YA
  664 --KWCVLRMPGPGMAQQAGM------------STEAFERFYFDVCC-LD---------YA
  665 --KWILFNVPTKAYAQLAEM------------STEAYTDFLYETCT-MD---------YS
  666 --RWVVTRYPTHAAAQEARM------------SLEEYEEYLFSACC-ID---------WE
  667 --KWVVTRYPTQGSAQEARM------------SLDEYEDYLFAACN-ID---------WS
  668 --RWVITRFPTHGAAQEAKM------------SLDEYEDYLYSACC-ID---------WH
  669 --RWVITRYPTHGAAQEAKM------------SLDEYEDYLFAACC-ID---------WH
  670 --RWVITRYPTHGAAQEAKM------------SLEEYEEYLFAACC-ID---------WE
  671 --RWVITRYPTQSAAQEARM------------SLDEYEDYLFAACC-MD---------WE
  672 --RWVITRYPTQSAAQEARM------------SLDEYEDYLFAACC-MD---------WE
  673 ---YTLTCIPTENDSKIDGI------------TYNDYIKLFFEM---CDQP-------WD
  674 QFGWTLCLLPTEELAANAGL------------SIEEYTAQIIKACY-LDSP--DPVAEWE
  675 --GWSLCLYPTDELAAKAGL------------TLEEYKNQIVQAVY-LDKD--DPVFIWE
  676 EFGWTLCLYPTKELAAKAGM------------TGREYAAQVTAACF-LKDA--DPVARWR
  677 EFGWTLCLYPTKELAAKAGM------------TGREYAAQVTAACF-LRDA--DPVARWR
  678 --GWTLCIFPTKELASKAGM------------TAKEYAAQVAAACF-LKEP--EPVALWR
  679 EFSWTLCLYPTAELAAKAGL------------SKKDYAAQVVAACF-LKDP--DPVARWR
  680 DFGWTLCVYPTAALAESAGL------------TMAEFKAQVVRACF-LDHE--DPPAKWT
  681 DFGWTLCIYPTPALAEAAKL------------SMADFKAQVVKACY-LDDG--NPPARWN
  682 ELGWTLCSYPTRALAESAGL------------TIKEFTDQIVKACY-LDEE--DPAACWK
  683 QFGWTLCLMPTPALAENAGL------------SPEDYAAQIIRASY-LDEA--DPVATWE
  684 EFGWTLCLYPTPALAEKAGL------------SIEEYARQIEKACY-LNMA--QPEQDWQ
  685 IFGWTLCMLPTEELAKHARL------------SIKQYTDEIAAACF-LNKK--SPVEEWQ
  686 DFAWTLCLCPTAELARHAGL------------SLEDYTRQIVKACF-LDKK--DPTAHWE
  687 AFGWTLGIVPTQELAKQAKL------------SLKAYTEQWIKACL-LDHD--DPAKEWQ
  688 LYAWTLCTVPTKDMAKQAGL------------PLDDYERQLIRACY-LDEQ--NPVGKWT
  689 AYGWTLCIWPTAALAGQAGL------------SLDDYADEVRRACL-LGEA--DPAATWA
  690 AYGWTLCIWPTAALAGQAGL------------SLADYADEVRRACL-LGEA--DPAATWA
  691 TYGWTLCLWPTPALAGWAGM------------NVEAYAKEIARACH-LGEA--DPVARWR
  692 AFGWTLCVYPTEAQAQAAGL------------SLAEYAHEIKNACL-LTEG--DPVQSWR
  693 KYTWTLAMWGTQQMADEVGM------------SLEEYWEQIIEACY-LKEE--KPADKWK
  694 -----VVIAPTSKSITHTLAKKEACERGARVATLPGITREIFVRTMSAD---------YE
  695 ---FAVKAQPDELRTRMQMTDVVNRRRMRHAHMVNIDRRIMLEGMR-AD---------FN

      9        20        21                 22        23          
      012345678901234567890123A45AB6ABCDEF789012345678901234A56AB7
                                                                  
                                                                  
    1 EHDALLSEKCEILNKYQFTELHYENEA--G------TDFRVGLVKNHIWEGGSE-ES--G
    2 EHDALLSEKCEILNKYQFTELHYENEA--G------TDFRVGLVKNHIWEGGSE-ES--G
    3 DHKTFLAQKCKILNTAHFDALHYQNSL--G------TDFTVGLQKDHIWEGGGE-FT--P
    4 RHNASFEEKVRFLNNKQFDAFVYKNAL--G------TNITVGMPKNHIWAGGSE-IA--E
    5 QFNKSFEDKTRFLNHSQFVKFIYKNSL--G------TDIEVGMPENHIWAGGSE-KA--A
    6 EHTTNLKARMDFLNSLTLRSLRYTNSL--G------TNLTIELPEDHIWLGGSE-YT--P
    7 EHKRNLKTRMDILNSLSLTTLRYTNSL--G------TDLQIKLPENHYWLGGSE-FT--P
    8 EHKGNLKRRSDLLNSLGLTSLHYKNSL--G------TDLTIELPENHIWLGGSE-YT--P
    9 EHKNNLKKRMDFLNTHNFKSLHYKNSL--G------TDLLITLPQKHQWLAGSD-YT--P
   10 NHKNNLKNRMNYLNAQDIKSLHYQNSL--G------TNLTIELPEGHLWLGGSE-FT--P
   11 EHKANLKRSMDFMNTHRFRTLHFKNSL--G------TDLWVELPEDHLWLAGAE-HT--A
   12 EHKANLKHSMDFMNTHRFRTLHFKNSL--G------TDLWIELPEDHLWLAGAE-HT--A
   13 IHKENLSRSMNILNTHRFQTLHFENSL--G------TDLWVELPEGHLWIAGAD-VT--P
   14 KHKENLQKSLEFMNSHRFRFLRYKNSL--G------TDFTVELPEDHLWLGGSE-RT--P
   15 NHQNNLKKSMDFLNKNNFKYLVYKNSL--G------TDLKIELPENHLWLGGSS-FT--P
   16 THKANLKKSMDFLNKSKFKYLMYKNSL--G------TDLKIELSKDHIWLGGSS-ST--P
   17 EHKRNLKNSMEFLNNHNLKSLQFRNDL--G------TDLEVELPEGYLFVGGSE-FT--P
   18 DHKSTLKKSMDFLNSNNFRYLHYKNSL--G------TDLKIELPKDHIWLGGAD-YT--P
   19 KHKETLKYHMDYLNEKNLKSLHFENSL--G------TDLTIELPENHLWAGGAE-YT--Q
   20 KHLNSLKENMNYLNKKKFKKLIYKNSL--G------TNLEIGLPEGHIWTAGGE-TS--K
   21 KHLNSLKENMNYLNKKKFKKLIYKNSL--G------TNLEIGLPEGHIWTAGGE-TS--K
   22 NHLNSLKKNMNYLNKKKFKKLIYKNSL--G------TNLEIGLPEGHIWTAGGE-TS--K
   23 KHLAILKGRMDYLNNKNFKKLIYKNSL--G------TNLEIGLPEGHKWISGGE-KS--K
   24 EHLNNLADKVNFLNDQKLTKLHYK-SK--D------TDLTIELPKGHIWCGGGE-YN--K
   25 KHLNNLADKVNFLNDQRLTKLHYK-SK--D------TDLTIELPKGHIWCGGGE-YN--K
   26 NHIKNLTEKVDFLNNNQFKSLHYK-SA--K------TDLVVELPENHVWAGGGE-YN--E
   27 EHISKLDHRRNYLNEKSFKYLHYK-SE--G------TDLVVELPEGHEWLAGAE-NT--K
   28 EHLEKLKNRKDYLNEKNFKYLYYK-SE--G------TDLTVELPEGHLWLSGEE-NS--K
   29 EHIAFLHKAADFLNANDFQELHYTNGL--G------TDLTIELPEGHIWAGGAE-KS--E
   30 KHTEFLQKAAAFLNEQKFTKLHYKNSM--G------TDLTIELPEGHIWSGGAE-KS--E
   31 KHIEFLACAAKFMNDHAFSRLEYKNGF--G------TNLFIELPEGHIWMGGAE-KT--Q
   32 THIDVLQKRTAFLNAQAFTELHYRNHL--G------TDLRIELPKGHIWMGGAE-KS--A
   33 THIARLQKTTAFLNAHAFSELHYQNGL--G------TDLRIELPKGHIWMGGAE-KS--A
   34 EHVSALQKTADFLNAHDFSELHYRNGL--G------TDLHVELPKGHIWMGGAE-RA--A
   35 EHVSALQKTADFLNAHDFSELHYRNGL--G------TDLHVELPKGHIWMGGAE-WA--A
   36 NHIDHLQKITEFLNAHDFAELHYTNCL--G------TDLHVELPPGHIWMGGAE-QS--A
   37 NHIDHLQKITEFLNAHDFAELHYTNCL--G------TDLHVELPPGHIWMGGAE-QS--A
   38 EHIDTLQKRAAFLNQCDFAELHYTNGL--G------TDLRVELPAGHLWMGGAE-HS--A
   39 EHIDTLQKRAAFLNQCDFAELHYTNGL--G------TDLRVELPAGHLWMGGAE-HS--A
   40 KHTKLLHDKVLELNSYKFKYLHFTNSL--G------TDLKIGLVQDHIWCGGED-IT--Q
   41 NHLENLNKKLLELNNHAFKYIHFTNSL--G------TDLKVELVKDHIWCGGKD-TT--K
   42 KHTETLSNKVQKLNNDRFKYLKFKNSL--G------TDLTIELVNNHLWCGGAD-KC--E
   43 EHNNNIDKKLEFLNSNKFQKLHYRNSK--G------TDLTIELPKDHIWLGGSE-KC--T
   44 AHTDNLAKKCAFLNEKKIKTLHYV-AP--G------TDLTVELPEGHKWEGGGE-CS--G
   45 RHIETLAQRKEKLNQLNFKFLHYTNSL--G------TDLTVELPEDHIWEAGDD-VT--L
   46 THIENLKSKLQYLNRKKYKMLHFK-GS--G------TDLRIELPEGHVWIGGGL-SN--D
   47 EHIEHMTQNADHLNDRDYRKLHYK-GP--G------TDFTVEIHSKSKWICAQF-TN--D
   48 KHIQSLSDKLDYFNKARFKKLHYK-GP--G------TDLVIELPDKHLWAGGGM-VN--D
   49 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   50 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   51 EHDKTLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   52 EHDKTLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   53 EHDKTLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   54 EHDKTLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   55 EHDKTLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   56 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   57 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   58 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   59 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   60 EHDETLHTKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   61 KHDETLHKKVDYLNEKHYKALHYT-GP--G------TDLTIELPEKHVWAGAGS-LN--E
   62 EHNASLHTKVDILNEKRFAKLHYK-AP--G------TDLTIELPDKHIWVGAGS-VN--E
   63 KHDQNLHEKVDHLNERHYAALHYQ-AE--G------TDLTIKLPRKHVWAGAGS-VN--E
   64 NHDQNLHEKVDHLNERHYAALHYQ-AE--G------TDLTIKLPRKHVWAGAGS-VN--E
   65 EHDQTLHEKVDHLNAKHYSALHYQ-AE--G------TDLTIELPKKHVWAGAGS-IN--E
   66 KHDQNLHEKVEHLNKKHYSALHYQ-AE--G------TDLTIELPKKHVWAGAGS-VN--E
   67 KHDQNLHEKVEHLNKKHYSALHYQ-AE--G------TDLTIELPKKHVWAGAGS-VN--E
   68 DHDQTLRDKVSVLNDKHYHALHYQ-AK--G------TDLTIELPEKHLWVGAGS-TN--E
   69 DHDQTLRDKVSVLNDKHYHALHYQ-AK--G------TDLTIELPEKHLWVGAGS-TN--E
   70 DHDQTLRDKVSVLNDKHYHALHYQ-AK--G------TDLTIELPEKHLWVGAGS-TN--E
   71 KHDESLNEKVKILNERHYHKLHYD-AP--G------TDLTIELPEQHIWVGAGS-VS--E
   72 DHDASLHEKVDYLNSKGFKKLHYT-AP--G------TDLTIELPEKHLWVGAGS-VN--E
   73 KHDETLHEKVDYLNSKRYQKLHYK-AP--G------TDLTIELPKGHLWVGAGS-IN--E
   74 KHDSALHEKVDYLNEKRYKKLHYK-AP--G------TDLTIELNDKHLWVGAGS-EN--E
   75 KHNETLHKKVQYLNNKRYKKLYYK-AP--G------TDLTIELPVNHLWVGAGS-VN--E
   76 DHDQNLHEKVDYLNSKKYKKLHYT-AP--G------TDLTIEFPEGYMWVGAGS-VS--E
   77 KHDKILHEKVEYLNQKRFHKLHYK-AP--G------TDLTIELPENHIWVGAGS-IN--E
   78 DHHAILNSKVDQLNAKQYRYLHYE-AP--G------TNLTIELPANHIWIGGGG-VN--K
   79 QHNDNLHEKVDYLNNKNYAKLHYT-AP--G------TDLTIELPKGHLWCGAGS-IN--E
   80 EHNRLLHTKVDYLNDKKYAKLHYT-SP--K------TDLEVALPKGHLWCGAGS-VN--E
   81 RHDENLHEKVDYLNGKHYHKLHYT-GP--D------TDLTIELPAKHLWCGAGS-IN--Q
   82 AHDKELHDKAEYLNSKQYKSLHYT-AP--G------TDLTIELPAHHIWTGGSS-VN--E
   83 AHDKELHDKADYLNSKQYKSLHYT-AP--G------TDLTIELPAHHIWTGGSS-AN--V
   84 AHDQELHSKADYLNAKQFKSLHYT-AP--G------TDLTIELPPHHVWTGGSS-IS--T
   85 EHNATLHKKVDILNGHHFHKLHYR-AP--G------TDLTIELPDKHLWVGAGS-TN--E
   86 EHDATLHEKVKILNSKKFHKLHYI-AP--G------TDLTIELPENHLWVGAGS-IN--E
   87 EHNTTLHSKAQALNESHFVKLHYT-AP--G------TDMTIGLADKHIWVAAGS-EN--Q
   88 AHNENLHAKVHVLNAKRYAKLHYR-AP--G------TDLTIELPEKHLWVGAAS-ET--K
   89 QHLEVLEAKSSVLNAKKYKKLHYV-AP--G------TDLTIELPEGHIWAQGDS-IN--E
   90 QHLEVLEAKSSVLNAKKYKKLHYV-AP--G------TDLTIELPEGHIWAQGDS-IN--E
   91 QHLEVLEAKSSVLNAKKYKKLHYI-AP--G------TDLTIELPEGHIWAQGDS-IN--E
   92 KHLAVLEQKSSVLNAKRYKKLHYV-AP--G------TDLTIELPEGHIWAQGDS-IN--E
   93 EHLKTLSSKSDILNAKRYKKLHYL-AP--G------TDLTIELAKDHLWVAAES-VN--Q
   94 EHLKTLSSKSDILNAKRYKKLHYL-AP--G------TDLTIELAKDHLWVAAES-VN--Q
   95 EHLKTLSSKSDILNAKRYKKLHYL-AP--G------TDLTIELAKDHLWVAAES-VN--Q
   96 QHIQNLTQKSDYLNAKRYKKLHYK-AP--G------TDLTIELPEGHLWVAAES-IN--A
   97 EHIRHLNAKSDFLNEKKFKKLHYT-AP--G------TDLTIELPEGHLWVAADS-IN--E
   98 EHIHTLQRKSDELNAKKYHKLRFT-SP--G------TDLTIELPEGHIWAQAGS-HN--E
   99 EHIHTLQRKSDELNAKKYHKLRFT-SP--G------TDLTIELPEGHIWAQAGS-HN--E
  100 DHIATLQRKSDELNQKKYSKLRFT-SP--G------TDLTIELPEGHIWAQAGS-HN--E
  101 AHIDTLQQKSDELNAKKYHKLRFT-SP--G------TDLTIELPEGHIWTQAGS-HN--E
  102 DHKEKLSEKVDFLNNKKFKSLHYK-AE--G------TDLTIELAEKHVWIGPES-IN--E
  103 SHLANLDEKMVALNEKHYEALHYT-AE--G------TDLTIELPESHLWVSGGS-TN--K
  104 NHLKTLNEKMNELNKRRYHALHYK-AP--G------TDLTIELPDTHLWVSGGS-TN--K
  105 QHLATLDEKRNKLNEHHFHALHYK-GK--G------TDLTIELPETHIWTSGGS-TS--N
  106 EHDENLQTKAKVLTEKQYKQLQYK-AP--G------TDLTIDLPEGHIWIGGGG-PN--E
  107 QHDENLQTKARFLTEKNYTKLHFQ-AP--G------TDLEIELPDNHIWIGGGG-PN--K
  108 NHDRTLAAKADSLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  109 NHDRTLAAKADSLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  110 NHDRTLAAKADSLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  111 NHDQTLAAKAESLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  112 NHDQTLAAKAESLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  113 NHDQTLAAKAESLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  114 NHDQTLAAKAESLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  115 NHDQTLAAKADSLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  116 NHDQTLAAKADSLNEKQFTSLHYT-AP--G------TDLTIGLPKNHLWVGAGS-KN--K
  117 AHDKNLAAKADELNEKQFKTLHYT-AP--G------TDLYIGLPENHLWVGAGS-YN--Q
  118 NHDATLNAKADELNEKQFKTLHYT-AP--G------TDLYIGLPEDHVWVGAGS-YN--A
  119 THDQSLRSRAKLLTEKKYAKLHYK-AP--G------TELTIGLPKKHVFLGGGG-PN--V
  120 QHDANLRTKATFLTEKKYNKLHYS-AP--G------TELTIELPERHVWLGGGG-PN--A
  121 KHNDRLARIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAA-TS--Q
  122 KHNDRLARIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAA-TS--Q
  123 EHNDRLARIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAA-TS--Q
  124 EHNDRLARIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAA-TS--Q
  125 EHNDRLARIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAA-TS--Q
  126 EHNDRLARIVDYLNNKQYKQLVYE-AP--G------PIFTVELVDGHVWHGGAA-TS--Q
  127 KHNDRLGRIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAS-TS--Q
  128 KHNDRLGRIVDYLNNKQYKQLVYE-AP--G------TNLTVELVDGHVWHGGAS-TS--Q
  129 QHNDKLAKIVDYLNDKQYKQLIYE-AP--G------TNLTIELVENHVWHGGAA-VS--Q
  130 QHNDKLAKIVDYLNDKQYKQLIYE-AP--G------TNLTIELVENHVWHGGAA-VS--Q
  131 QHNDRLAKIVDYLNNKQYQQLIYE-AP--G------TNLTIELVENHVWHGGAA-VS--E
  132 THNEKLARIVDYLNNKQYKQLIYD-GP--G------TNLTVELPDGHVWAGGAA-KN--T
  133 EHNARLAQTVSYLNEKRYKQLVYE-AS--G------TSLTVDLPEKHLWLGGAK-EN--A
  134 EHNERLRQAREYLNKKQYRKLHYK-AP--G------TELSIELVEDHIWHGGSA-TS--Q
  135 AHNETLKTAREILNRKKYTKLIYK-AP--G------TDLEIGLPQGHIWKGGSA-VS--E
  136 DHNETLRTAREILNEKNYKKLIFR-AP--G------TDLEMELPEGHIWKGGSA-VS--E
  137 QHNETLKTAREVLNDKDYKKLIFK-AP--G------TDLEMELPDGHIWKGGSA-EA--E
  138 EHNETLIKARGYLNKKQYSKLVYK-AP--G------TDLEVALPKGHIWKGGPA-TT--E
  139 EHLATLRAKVERMNAKKYARLIYR-AP--G------TELNVELPPEHQWVAGGV-HN--A
  140 EHNSFLLAKRAYLDAKQYKKLHYR-AP--G------TDLVIELPDNHLWNGGIS-KN--E
  141 AHIKQLKSKAKYLNDKAYKYLHYV-AP--G------TDLTLEMPKDQIWLGGSK-QN--E
  142 QHVTNLESRAELLNNKKYAKLHYT-AP--G------TDLTIALAPQHKWLTGGS-KT--P
  143 QHVTNLESRAELLNNKKYAKLHYT-AP--G------TDLTIALAPQHKWVTGGS-KT--P
  144 QHVANLESRAQLLNNKKYAKLHYT-AP--G------TDLTIALAPQHKWLTGGS-KT--P
  145 EHVTNLESRAVLLNNKKYMKLHYT-AP--G------TDLTIALAPQYKWITGGG-KT--P
  146 EHVTNLESRAVLLNNKKYMKLHYT-AP--G------TDLTIALATQHKWITGGG-KT--P
  147 EHVKNLESRAVLLNNKKYIKLHYT-AP--G------TDLTIALAPQHKWITGGG-KT--P
  148 EHVKNLESRAVLLNNKKYIKLHYT-AP--G------TDLTIALAPQHKWITGGG-KT--P
  149 EHVTNLESRAVLLNDKKYMKLHYT-TP--G------TDLTIALAPQHKWVTGGG-KT--P
  150 EHVTNLESRAVLLNDKKYMKLHYT-AP--G------TDLTIALAPQHKWVTGGG-KT--P
  151 EHVTNLESRAVLLNDKKYMKLHYT-AP--G------TDLTIALAPQHKWVTGGG-KT--P
  152 THIENLHARADQLNKKKYAKLHYT-AP--G------TDLTIELPEKHLWKSGSS-EA--P
  153 NHIAFLEKRATQLNEKRYVKLQYS-AP--G------TDLTIELPDKHIWMSGAS-KT--P
  154 EHIGQLKQVKERLNEKKYKKLHYR-AP--G------TDLSVELPEGHIWHGGGT-TD--D
  155 EHIAQLSETHERLTAKKYRRLHYK-AP--G------TDLSVELPEGHLWLGGGG-EN--E
  156 DHIAGLKLRQNHMNAKRYKSFHYR-AP--G------TDLRVDMPEGYLWLGGGD-EN--E
  157 DHIAGLKLRQNHMNAKRYKSFHYR-AP--G------TDLRVDMPEGYLWLGGGD-EN--E
  158 DHIAQLKLRQNHMNAKRYKSFHYR-AP--G------TDLRVDMPERYLWLGGGD-EN--E
  159 EHIAQLKEKQNHMNAKRYKSFHYR-AP--G------TDLHIDMPEGYRWLGGGD-EN--E
  160 NHLKNLEQVQDKLNHKKYKSLHYR-AP--G------TDLRIELADGHIWRSGGG-EN--G
  161 NHLKNLEQLQNKLNHKKYKSLHYR-AS--G------TDLKIELADGHIWRSGGG-EN--E
  162 EHLKNLEQLQNKLNHKKYKSLHYR-AP--G------TDLKIELADGHIWRSGGG-EN--E
  163 KHLKNLEQLQNKLNHKNYKSLHYR-AP--G------TDLKIELAERHIWRGGGG-EN--A
  164 EHNENLKSKMDFLNKNNFKTLKYKSSK---------TDLTLDLPKGHVWLSGAS-KD--P
  165 EHNNNLKEKTDFLNSKKFKTLKYKSKI---------TDLTVEMPEGHIWESGSE-KD--V
  166 EHIANLKKRTDFLNESDFKTLKYSSAK---------TNLSIDLPEGHIWLSGDA-KD--P
  167 IHNKNLHDKRDFLNEMNFKELRYKSSK---------TDLVVGLPEGHIWESGAS-FD--P
  168 DHNKNLKEKTAFMNKMNFKELRYKSSK---------TDLVIGLPDNHIWLGGAA-KD--P
  169 KQKQTLANKVAFLNKKKYKQLHYK-AP--G------TDLKIAFDPDYHWDGGAA-VN--S
  170 KHNEAMHKASEFMNRMNFKQLIYS-AP--G------TDLTIDLPQGHIWSGGSG-PS--T
  171 NHDKTLQEKANELNEEQFTALHYT-AP--G------TDIIIGLPKNHLWEGAGS-FN--A
  172 NHDKTLQEKANELNEEQFTALHYT-AP--G------TDIIIGLPKNHLWEGAGS-FN--A
  173 KHDETLQVKAEELNKEQFSALHYT-AP--G------TDLIIGLPKNHLWEGAGS-YN--T
  174 IHDKKLQEKAAELNEQQFTALHYT-AP--G------TDLTIGLPKNHLWEGAGS-YN--A
  175 IHDKKLQEKAAELNEQQFTALHYT-AP--G------TDLTIGLPKNHLWEGAGS-YN--A
  176 IHDKKLQEKAAELNEQQFTALHYT-AP--G------TDLTIGLPKNHLWEGAGS-YN--A
  177 IHDKKLQEKAAELNEQQFTALHYT-AP--G------TDLTIGLPKNHLWEGAGS-YN--A
  178 IHDKKLQEKAAELNEQQFTALHYT-AP--G------TDLTIGLPKNHLWEGAGS-YN--A
  179 KHDEKLAKKAEELNREQFSALHYT-AP--G------TDIIIGLPKNHLWEGAGS-YN--A
  180 KHDDALEAKANELNEQQFDTLHYK-AP--G------TDLTIGLPKNHLWEGAGS-FN--A
  181 NHDELLRKKANELNAEQFDALHYT-AP--G------TDLTIGLPSGHIWEGAGS-FN--S
  182 KKDITLNEKAEELNKEQFVALHYT-AP--G------TDLTVGLPEGHRWEGAGS-DN--V
  183 KKDITLNEKADELNKEQFVALHYT-AP--G------TDLTVGLPEGHRWEGAGS-DN--V
  184 KKDKTLTTKADELNDEQFVALHYT-AP--G------TDLTIGLPDGHRWEGAGS-DN--V
  185 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  186 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  187 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  188 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  189 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  190 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-VN--A
  191 DHAAILKSKADMLNKEQFSALHYT-GP--G------TDLTLGLPKNHVWESAGA-IN--A
  192 NHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  193 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-VN--A
  194 EHAAILKSKAEMLNREQFSALHYM-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  195 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-VN--A
  196 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-VN--A
  197 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-VN--A
  198 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  199 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  200 EHAAILKSKADMLNKEQFSALHYT-AP--G------TDLTLGLPKDHVWESAGA-IN--A
  201 EHAAILKSKAQMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  202 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  203 EHAAILKSKAEMLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  204 EHAAILKSKADTLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  205 EHAAILKSKADTLNKEQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  206 AHEEKLSSKAKVLNEEQFTALHYT-AP--G------TDLTLGLPKNHHWESAGS-LN--A
  207 AHEEKLSSKAKILNEEQFSALHYT-AP--G------TDLTLGLPKNHHWESAGS-LN--A
  208 AHEEKLSSKAKILNEEQFSALHYT-AP--G------TDLTLGLPKNHHWESAGS-LN--A
  209 AHEEKLSSKAKVLNEEQFSALHYT-AP--G------TDLTLGLPKNHHWESAGS-LN--A
  210 AHEEKLSSKAKVLNEEQFTALHYT-AP--G------TDLTLGLPKNHHWESAGA-VN--A
  211 AHEEKLSSKAKVLNEEQFTALHYT-AP--G------TDLTLGLPKNHHWESAGS-LN--A
  212 EHADRLDAKARLLNEAQFSALHYQ-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  213 EHADRLDAKARLLNEAQFSALHYQ-AP--G------TDLTLGLPKNHVWESARA-IN--A
  214 EHADRLDAKARILNEAQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--T
  215 EHADRLDAKARILNEAQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  216 EHADRLDAKARILNEAQFSALHYT-AP--G------TDLTLGLPKNHVWESAGA-IN--A
  217 EHEARLVAKAKVLNDEQFVKLHYT-AP--G------TDLVLGMPKNHLWEAAGS-VN--A
  218 EHEEKLDAKAAILNKEQFVKLHYT-AP--G------TDLTLGMPKNHVWESAGS-IN--A
  219 EHEEKLDKKAAILNKEQFAKLHYT-AP--G------TDLTLGMPKNHVWESAGS-IN--A
  220 QHKQTLNEKAAKLNDIQFDALHYT-AP--G------TDLTLGLPKNHIWASAGS-VN--P
  221 DHQAKLEAKAKLLNDYQFDALHYT-AP--G------TDLTLGMPENHLWEAAGS-KN--A
  222 DHQAKLEAKAKILNDYQFDALHYV-AP--G------TDLTLGMPENHLWEAAGS-KN--A
  223 LHQEKLVAKATILNDYQFDALHYM-AP--G------TDLTLGMPENHLWEAAGS-VN--A
  224 LHQEKLVAKATILNDYQFDALHYM-AP--G------TDLTLGMPENHLWEAAGS-VN--A
  225 DHQARLVSKANLLNDYQFDALHYM-AP--G------TDLTLGMPENHVWEAAGS-VN--A
  226 DHQEKLVSKAKILNDYQFDALHYM-AP--G------TDLTLGMPENHLWEAAGS-VN--A
  227 EHQERLESKAAILNKYQFDALHYR-AP--G------TDLTLGMPKNHLWEAAGS-VN--A
  228 QHQERLEKKARLLNDYQFDSLHYR-AP--G------TDLRLGMPEQHIWEAAGS-TN--A
  229 LHQEKLLSKAEQLNKYQFDALHYM-AP--G------TDLTLGMPENHYWEAAGS-TN--A
  230 AHEAKLLEKATRLNQEQFDALHYT-AP--G------TDLTLGMPKNHIWEAAGS-LN--A
  231 EHENRLNEKAAFLNDHQFDALHYT-GP--G------TDLTIGLPKNHIWESAGS-TN--E
  232 DHEAKLQEKAKYLNDQQFDQLHYT-GP--G------TDFTVGMPKNHVWESAGS-HN--E
  233 QHVETLDQKAKFLNDTQFDALHYT-GP--G------TDLVLGLPKNHVWESAGS-LN--R
  234 KHRDLLDEKAQKLNDNQFKKLHYT-AP--G------TDLTLGLPEGHIWVSAQS-FN--P
  235 KHDETLRTKADWLNKEQFKALHYT-SP--I------TDITVGLPKNHIWEGAGS-YN--A
  236 KHDETLRTKADWLNKEQFKALHYT-SP--I------TDITVGLPKNHIWEGAGS-YN--A
  237 EHDQTLRNKAKWLNDEQFVALHYT-SP--K------TDLTIGLPKNHIWEGAGS-FS--V
  238 EHDQKLHEKSDWLNEQQFSALHYV-SP--V------TDITIGLPENHVWEGAGS-FT--P
  239 EHKDQLESKAAWLNEQQFDTLQYH-SP--R------TDMEVGLPKNHVWVGAGS-TS--A
  240 RHAEKLHEKAAWLNEEQFKELHYT-SP--V------TDLTIGLPKNHYWAGGSK-EN--S
  241 AHDQKLREKAAWLNNEQFDQLHYM-AP--G------TDLVVGLPKNHIWEGAGA-FN--P
  242 THDQKLSAKAKWLTNEQFDQLHYM-AP--G------TDLVVGLPKNHIWKGGGA-FN--P
  243 AHDQQLRTKADWLNAEQFDRLHYV-AP--G------TDLVVGLPKHHIWKGAGA-YN--P
  244 AHDHQLRTKADWLNAEQFDRLHYV-AP--G------TDLVVGLPKHHIWEGAGA-YN--P
  245 AHDQQLRTKADWLNAEQFDRLHYV-AP--G------IDLVVGLPKHHIWEGAGA-YN--P
  246 QHGKKLQAKAAELNAAQYKALHYT-AP--G------TDLTIGLPENHIWMGGPS-RS--S
  247 EHGKKLQAKAAELNAAQFKALHYT-AP--G------TDLTIGLPENHIWIGGPN-QS--S
  248 QHAAELKAYATKLNQLPLDRLHYY-SA--K------TDLTIGLPKNYNWSGATS-EN--S
  249 QHINTLNEKAAWLNEQNFKALQYH-SA--K------TDLTIGLAEDHVWEAAES-FN--K
  250 EHIETLNEKAAWLNQQNFKAIQYH-SE--K------TSLTVGLAEDHVWEAAES-FN--K
  251 AHVNTLKEKAQWLNDLNFKELHYS-SP--I------TDLTVGLAEDHVWEAADS-ID--K
  252 QHIKKLSTKAAWLTQENFKEIHFT-SN--Q------TDLTVGLAQDHVWEGADS-FD--K
  253 DHIETLKAKADWLNAKNFKALRYK-NA--V------SDFTIGLAEGHIWEAALS-QD--K
  254 DHIETLKAKADWLNAQNFKALHYK-NA--V------SDFTIGLAEGHIWEAALS-QD--K
  255 THIETLKNKADWLNSQNFKSLHYH-NA--K------SDFTIGLATGHIWEAAFS-YD--K
  256 THIEHLKEKADWLNEQNFKELHYK-ND--K------SDFTIGLATGHIWEAAFS-HD--K
  257 THIEHLKEKADWLNEQNFKELHYK-ND--K------SDFTIGLATGHIWEAAFS-HD--K
  258 LHINKLKNKADWLNEQNFKELHYK-NA--K------SAFTIGLAEGHVWEAAYS-QD--K
  259 HHIKKLQAKADWLNQQNFKALHYK-NA--K------SDFTIGLAEGHIWEAAIS-QD--K
  260 RHIKTLQEKADWLNQHNFKSLHYK-NE--H------SDFTIGLAAGHIWEAAFS-HN--K
  261 QHVAELKAHADWLTEQNFKELRYK-SA--K------SDFTIGLAEHHRWEAASS-VD--Q
  262 EKVKDLSLHAKWLNDQNFDHLKYT-AP--G------TDLTVGLPEGHIWEAADS-TD--A
  263 NKIADLAHHADWLNQQAFAALHYQ-AP--G------TDLTVGLPKGHIWVAADA-KD--A
  264 EHRQNLTEKAEFLNNKNFVALHYT-SK--G------TDLTVGLPKNHIWVAAGS-KN--A
  265 EHRQNLTEKAEFLNNKNFVALHYT-SK--G------TDLTVGLPKNHIWVAAGS-KN--A
  266 EHHKILSEKADYLNKKAFSALHYT-AP--G------TDLTVGLPKNHVWIAAGS-KN--L
  267 THNQNLHSKADYLNNKKYVALRYK-AP--G------TDLEIGLPEGHIWCGASS-IN--K
  268 KHVKSLSVHAERLQKKNYKALHYI-SE--G------TDLTVGLPEGHLWEDATSYVN--G
  269 KHVKSLSVHAERLQKKNYKALHYI-SE--G------TDLTVGLPEGHLWEDATSYVN--G
  270 AHVKSLSVHAKRLQEKNYKALHYI-SE--G------TDLTVGLPKGHLWEDATSYVN--G
  271 KHIKDLSVHAKRLQEKNYQALHYI-SE--G------TDLIVGLPKGHIWEDATSYVN--G
  272 KHIKDLSVHAKRLQEKNYQALHYI-SE--G------TDLIVGLPKGHIWEDATSYVN--G
  273 KHIKDLSVHAKRLQEKNYQALHYI-SE--G------TDLIVGLPKGHIWEDATSYVN--G
  274 QHVKSLSVHANKLQEKNYKALHYM-SE--G------TDLTVGLPKGHIWEDATSYVN--G
  275 SHVKNLSVHADKLQKKQYKALHYL-SE--G------TDLVVGLPKGHIWEDATSYVN--G
  276 SHVKNLSVHADKLQKKQYKALHYL-SE--G------TDLVVGLPKGHIWEDATSYVN--G
  277 KHIENLSVHAKLMQEKNYKALHYQ-SE--G------TDLVVGLPKGHIWEDATSYVN--G
  278 QHIANLSVYAQKLQQKNYHALHYV-SE--G------TDLTVGLAKNHIWEDATSYVN--G
  279 QHIANLSVYAQKLQQKNYHALHYV-SE--G------TDLTVGLAKNHIWEDATSYVN--G
  280 QHIANLSVYAQKLQQKNYHALHYV-SE--G------TDLTVGLAKNHIWEDATSYVN--G
  281 QHIANLSVYAQKLQQKNYHALHYV-SE--G------TDLTVGLAKNHIWEDATSYVN--G
  282 QHIANLSVYSKKLQQKNYQALHYI-SE--G------TDLTVGLVKNHIWEDATSYVN--G
  283 EHVKNLSVHADKLQRKQYKALHYI-SK--G------TDLEVGLPNGHIWEDATSYVN--G
  284 QHIKNLSVYSNKLQQKNYKALHYV-SE--G------TDLVVGLPENHIWEDATSYVN--H
  285 KHVDNLSQRAKSLQLKNYKAFHYV-SE--G------TDLEIGLPDGHIWEDATSYTS---
  286 NHVENLSIHARKLQDKNYKALHYI-SE--G------TDLVIGLPEGHIWEDATSYTS---
  287 AHVDNLSVHADYLQKANFKALHYV-SE--G------TDLTIGLPEGHIWEDATSYTS---
  288 KHIENLSKHAKYLQDKHYSALHYI-SE--G------TDLTIGLPENHLWQDATSFTN---
  289 RHAQNLKVRAAMLNDKAYTALHFV-SE--G------TDLHIGLPKGHIWEEPMS-YT--E
  290 KNIETLTTKSKWLNEMEFESLHYTSSN--G------TDLVIGLPKGHIWRAAYT-AN--R
  291 EHIEKLSIKANWLNDLDLKTLKYKASN--G------TDLEIELPEGHIWTASSS-VN--S
  292 EHIEKLSIKANWLNDLDLKTLKYKASN--G------TDLEIELPEGHIWTASSS-VN--S
  293 EHLDTMDKHAEFMNKHQFVKLHYTNSL--G------TDLTIELPKGHVWMAAQS-TD--N
  294 -----------FMNKHQFVKLHYTNSL--G------TDLTIELPKGHVWMAAQS-TD--N
  295 EHLDTMNKHAEFMNKHQFVKLHYTNSL--G------TDLTIELPKGHVWIAAQS-TD--N
  296 EHISELSRRAKYLNEKQFKYLKYSSKK--G------TDLTIELPKNHIWNAAGSGFN--A
  297 EHISELSRRAKYLNEKQFKYLKYSSKK--G------TNLTIELPKNHVWNAAGSGYN--A
  298 EHINELSRRAKYLNEKQFKYLKYSSKK--G------TNLTIELPKNHVWNAAGSGFN--S
  299 NHLSRLNALADKLNHYQFDSLIYKNSL--G------TDLTIGLPENHIWSAADS-KT--P
  300 THSNNLKKWSDFLNEKQFEFLEYHSEN--G------TDLKIRLPENHIFSGASE-FN--R
  301 EHINNLKKWSNFLNENEFEMLHFKSEK--G------TDLKVKLPKGYIFAGASE-YA--K
  302 EHIATMKKHSKILNEAKLKELHYTSEK--G------TDLHVKLPKGYIFTGGDE-IN--K
  303 KHIENLEKYAEFLNKNNFRYLHYKSKK--G------TDLIVELPKGYIFVGSEE-KN--S
  304 KHIENLDKYAEFLNKNNFRYLHYKSKK--G------TDLIVELPKGYIFVGSEE-KN--S
  305 NHVDNLNRYSKFLNEAKFEKLIYKSKK--G------TDLEVGLPKGYIFAGAGD-VN--S
  306 EHISILDEKAKFLHENELVKLHITNEL--G------TDLYVGLPKGHIWQSAGS-YA--K
  307 EHIRVLDEKAKFLHENELVKLHITNDL--G------TDLYVGLPKNHIWQSAGS-YA--K
  308 EHISVLDAKGKFLIESNLEKLHITNDL--G------TDLIVGLPEGHIWQSAGS-YA--K
  309 KHIDNLDEKAKFLNDHQFDKVHYKASN--G------TDLWVKLPKNHIWMSAGS-TN--E
  310 NHINTLDEKAKFLNDHQFDKVHYKSSN--G------TDLWVKLPKNHIWMSAGS-KN--E
  311 DHLKTLDDKAEFLNSHQFEYVHYKSAN--G------TDLKVKLPKNHIWMSAGS-KN--A
  312 DHINLLNEKAEFLNSHQFDEVHYKSKN--G------TDLRVKLPKNHIWMSASS-KN--E
  313 DHVSLLNEKAEFLNSHQFDEVHYSSKN--G------TDLRVKLPKNHIWMSASS-KN--E
  314 DHINLLNEKAEFLNSHQFDEVHYKSKN--G------TDLRVKLPKNHIWMSASS-KN--E
  315 QHIANLKRRAAWLNGLKIHALHYR-AP--G------TDLTIELAEGHYFEAAGH-PD--V
  316 EHLENLKKRAKWLTDLRIRRLHYR-AP--G------TDLTVGLPETHYWAAASN-QT--P
  317 DLQENFARREQILNTHRFQKLHFENAG--G------TDLWVELVKNHLWAGGSE-KT--V
  318 DLQENFARREQILNTHRFQKLHFENAG--G------TDLWVELVKNHLWAGGSE-KT--V
  319 DLQENFARREQILNTHRFQKLHFENAG--G------TDLWVELVKNHLWAGGSE-KT--V
  320 DLQENFARREQILNTHRFQKLHFENAG--G------TDLWVELVKNHLWAGGSE-KT--V
  321 RLQENFTRREEILNNHRFEKLHFENEQ--G------TDLWVTLVHHHIWAGGSE-KT--V
  322 EMQNNFVRRIQALNEHKFKALHFTNCL--G------TDLTVELVDHHIWAGGSE-KT--V
  323 EMQNNFVRRIQALNEHKFKALHFTNCL--G------TDLTVELVDHHIWAGGSE-KT--V
  324 KRDAVFAKRCQILNDFRFQSLHFTNSM--G------TDLRIGLVEGHLWAGGSE-KT--P
  325 KHNRQLSERNDWLNRQRFAALHFKNQK--G------TDLIVELAEGHLWEGGCE-KS--Q
  326 IHDGNLVEYARKLTELNFKQLHFTSEL--G------TDLTVELVDNHVWIGGGD-MT--P
  327 EHDARLTAYAKTMTNYQFTKLHFISEL--G------TDLEVGLVEDNIWEGGGS-IS--A
  328 KHNAKLSHQNQILNDYNFKSLHFKNGK--G------TDIVVGLVDNHVWAGGEE-VS--E
  329 KHNEYLARNNKILNDANFKNLHFTNSL--G------TDLIVELIQDHVWAGGSE-KA--G
  330 EHIDNLKRITKFLNEKQFDYLKYE-GP--G------TDLTVGLPENHIWLSATQ-EN--M
  331 KHIKQLNRITDFLNERQFDYLIYE-GP--G------TDLQVGLPKDHVWISGSQ-KN--S
  332 KHIENLNKRTEFLNKRQYEYLRYK-GP--G------TDLMVGMPENHIWVAGTQ-KN--V
  333 AHLERLKNRKDYLNNMKFEALRYE-GP--G------TDLIVKLPKKHLWLSGIE-HD--V
  334 EHLENLKRRKDYLNKAHFEALRYE-GP--N------TNLTVKLAPKHIWLSGVE-HD--I
  335 DHFEKLEKFKIYLNEKQFAKLYYK-GE--N------TDLTVDLPKNHIWQGGCE-HT--T
  336 NHLNDLKKRRQWLTDKAFKALHYKNDR--G------TDLTVGLPKHHIWQGGTE-ES--A
  337 IHLENLKKRRTWLTAQAFTALHYTNRA--G------TDLTVGLPKGHIWQGGTE-ES--A
  338 KHLAELKQRREWLTAQQFTALEYENGL--G------THLTVGLPDRHIWQGGAE-ST--A
  339 SHLAELKKRRTWMTDQHFTSLHYTNSL--G------TDLTLGLPDGHIWQGGME-ET--A
  340 RHLLQLERRRRWLTAHHFVSLHYKNAR--G------TDLQIGLPEHHIWQGGQE-ET--A
  341 RHLLQLERRRRWLTAHHFVSLHYKNAR--G------TDLQIGLPEHHIWQGGQE-ET--A
  342 HHMAKLRHRCEALNKLDLKALRYTCKN--G------TDLLLELPEGHIWLGGEE-SS--K
  343 HHMAKLRHRCEALNKLDLKSLLYTCEN--G------TNLLLELPEGHIWLGGEE-SS--K
  344 HHMAKLRHRCEALNKLDLKALRYTCEN--G------TDLLLELPEGHIWLGGEE-SS--K
  345 HHMAKLRRRREAINKLDLKALRYTCEN--G------TDLLLELPEGHIWQGGEE-AS--K
  346 HHMAKLRHRREAINKLDLKALRYTCEN--G------TDLLLELPEGHIWQGGEE-AS--K
  347 HHMAKLRHRREAINKLDLKALRYTCEN--G------TDLLLELPEGHIWQGGEE-AS--K
  348 HHMAKLRHRREALNALDLKALRYTCEN--G------TDLLLELPEDHIWQGGEE-FS--K
  349 NHLDRLAKRTKTLNDLQLVSLHYTCPN--G------TDLTLQMPKGHLWLGGKE-SS--K
  350 EHNEQLKRHQKFLTEMNFEKLLYR-AP--G------TELEVYLTEGHRWMGGSA-QT--L
  351 EHDAALKKHQNFLNEMAFEKLLYK-GP--G------TDLEVYLTEGHRWVGGSG-KS--T
  352 EHDRNIKKYRDFLNEKQFEKLVFK-AP--G------TDLEVYLAEEHFWMGGSK-ES--L
  353 KHLDRLNELGAKMNALDLESVHFESAN--G------TDLTVGLAEQAVWESAGS-KN--E
  354 AHVKKMTAWRDRMNALDLDSIRLQSAN--G------TDLTIGLADGHVWEGAQS-RT--P
  355 EHVAKTAARRDQLNAWNLDRVHITSGN--G------TDLTVGIAQDATWEGASS-KS--E
  356 AHNRALHEKVAYLNARRFHALHFK-GP--G------TDLVVGLAEGHLWQGGAT-AT--K
  357 AHNRALHEKVAYLNARRFHALHFK-GP--G------TDLVVGLAEGHLWQGGAT-AT--K
  358 AHNRALHEKVAYLNARRFHALHFK-GP--G------TDLVVGLAEGHLWQGGAT-XT--K
  359 AHNRALHAKVAYLNARRFQALHFR-GP--G------TDLTVGLAEGHLWRGGAT-PT--Q
  360 AHNRVLHAKVAFLNEKRFHALHFQ-GP--G------TDLTVGLAEGHLWQGGAT-PT--K
  361 AHNRSLHEKVAFLNAKRFAALHFQ-GP--G------TDLTVGLAEGHLWQGGAT-PT--K
  362 AHVATLRARCDALNARRFAALRFS-GP--G------TDLEVGLADGHLWAGGSA-TS--K
  363 AHVATLRARCDALNARRFAALRFS-GP--G------TDLEVGLADGHLWAGGSA-TS--K
  364 AHNANLHKRVQFLNEKRYAALHFK-GP--G------TDLKVGLADDHVWSGGAA-VA--K
  365 AHNQRLAERVAYLNQKRYHALHFK-GP--G------TDLLVGLAEDHLWAGGAV-QA--K
  366 AHNRELAARREHLDARRYAALRFR-GP--G------TDLTVGLADDHVWQGGAS-MA--A
  367 EHNAELHARTARLNSRRYAALRFR-GP--G------TDLTVGLADEHEWAGGAS-TA--K
  368 AHNAALHRRTETLNARRYAALRFR-GP--G------TDLTVGLADDHEWCGGAS-AS--K
  369 AHNAALRRRTDRLNGRRYAALRFQ-GP--G------TDLTVGLADDHEWCGGAS-AS--R
  370 AHNRDLARRTERLNGARFSALRFR-GP--G------TDLTVGLADDHEWCGGAT-TA--K
  371 AHNRDLARRTERLNGARFSALRFR-GP--G------TDLTVGLADDHEWCGGAT-TA--K
  372 THNRDLARRTERLNGARFSALRFR-GP--G------TDLTVGLADDHEWCGGAT-TA--K
  373 EHNRDLARRTERLNGSRFSALRFR-GP--G------TDLTVGLADDHEWCGGAT-TA--K
  374 AHNAALRQRTDWLNSQRFHALHYS-GP--G------TDLTVGLADGHEWVGGAS-AA--K
  375 AHNAALRQRTDWLNSQRFHALHYA-GP--D------TDLTVGLADGHEWVGGAS-MA--R
  376 AHNAALRQRTDWLNGQRFRALHYS-GP--G------TDLTVGLADGHEWVGGAS-TA--K
  377 AHNAALRTRTEWLNDKRFSALHFT-GP--G------TDLVVGLADGHEWQGGAS-MA--K
  378 RHNAVLRERTEWLNGQRFSALHYT-GP--G------MDLTIGLADGHEWEGGAS-TA--K
  379 KHNAVLRERTEWLNGQRFSALHYT-GP--G------MDLTIGLADGHEWEGGAS-TA--K
  380 RHNAVLRERTEWLNGQRFSALHYT-GP--G------MDLTIGLADGHEWEGGAS-TA--K
  381 RHNAVLRERTEWLNGQRFSALHYT-GP--G------MDLTIGLADGHEWEGGAS-TA--K
  382 RHNAVLRERTEWLNSQRFSALHYT-GP--G------MDLTIGLADGHEWEGGAS-TA--K
  383 RHNAVLRKRTDWLNGQRFSALHYT-GP--G------MDLTIGLADGHEWEGGAS-TA--K
  384 SHNAVLRERTNWLNGQRFRALQYS-GP--G------TDLTIGLADGHEWEGGAS-LS--K
  385 SHNAVLRERTNWLNGQRFRALQYS-GP--G------TDLTIGLADGHEWEGGAS-LS--K
  386 SHNAVLRERTNWLNGQRFRALQYS-GP--G------TDLTIGLADGHEWEGGAS-LS--K
  387 SHNAVLRERTNWLNGQRFRALQYS-GP--G------TDLTIGLADGHEWEGGAS-LS--K
  388 AHNTALRSRTEWLNGHNFHALHFT-GP--G------TDLTVGLADGHEWMGGAS-TA--K
  389 AHNAALRGRTEWLNGHNFHALHFT-GP--G------TDLTVGLADGHEWMGGAS-TA--K
  390 AHNAALRGRTEWLNGHDFHALHFA-GP--G------TDLTVGLADGHEWMGGAS-TA--K
  391 AHNAALRGRTEWLNGHNFHALHFT-GP--G------TDLTVGLADGHEWMGGAS-TA--K
  392 AHNAALRSRTEWLNGHNFHALHFT-GP--G------TDLTVGLADGHEWMGGAS-TA--K
  393 AHNAELRARTAWLNGQRFAGLHYL-GP--G------TDLTIGLADGHEWQGGES-TA--K
  394 EHNANLAKRSAWLNGERFASLHFT-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  395 EHNANLAKRSAWLNGERFASLHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  396 EHNANLAKRSAWLNGERFASLHFR-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  397 EHNANLRKRSEWMNGQRFATLHFQ-GP--G------TNLKVGLADGHEWHGGAS-TA--K
  398 EHNANLHQRSNWLNEERFAALHFT-GP--G------TNLTIGLADGHEWHGGAS-VA--K
  399 EHNANLHRRSAWLDEERFAALHFT-GP--G------TDLTVGLADGHEWHGGAS-VA--K
  400 EHNANLRRRSAWLNEARFAALHFS-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  401 EHNANLRRRSAWLNDERFAALHFT-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  402 AHNGELAKRSAWLNGERFSSLHFT-GP--G------TDLRVGLADGHEWHGGAS-TA--K
  403 IHNGELAKRSAWLNGERFSALHFT-GP--G------TDLTVGLADGHEWHGGAS-IA--K
  404 QHNANLAKRSAWLNGERFSALHFT-GP--G------TDVKIGLADGHEWHGGAS-MA--K
  405 QHNANLAKRSAWLNGERFSALHFT-GP--G------TDVKIGLADGHEWHGGAS-MA--K
  406 EHNANLAKRSAWLNGERFSSLHFT-GP--G------TDVKIGLADGHEWHGGAS-TA--K
  407 EHNANLAKRSAWLNGERFSSLHFT-GP--G------TDVKIGLADGHEWHGGAS-TA--K
  408 AHNAALRTRTRFLNGKAYSALHFK-GP--N------TDLTVGLADGHEWHGGAS-TA--K
  409 AHNAALRTRTRFLNGKAYSALHFK-GP--N------TDLTVGLADGHEWHGGAS-TA--K
  410 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  411 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  412 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  413 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  414 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  415 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  416 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  417 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  418 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAC-TG--K
  419 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  420 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  421 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  422 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  423 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  424 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  425 AHNAALRTCTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  426 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  427 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  428 AHNAALRTRTRFLNGKAFSALHFK-GP--G------TDLTVGLADGHEWHGGAS-TA--K
  429 AHNANLAQKSGWLNGQRFASLHFT-GP--G------TDLMVGLADGHEWHGGAS-LA--K
  430 QHNAEIHARRDWLNEMKFRDLHFT-AP--G------TDLVVGLADDHEWAGGAS-LA--K
  431 AHNANLKQRSSWLNDQRFAALHFT-SP--G------TDLTVGLADEHEWHGGAS-IA--Q
  432 AHNANLKQRSSWLNDQRFAALHFT-GP--G------TDLTVGLADEHEWHGGAS-IA--Q
  433 AHNANLKQRSSWLNEQRFIALHFT-GP--G------TDLMVGLADEHEWHGGAS-IA--Q
  434 AHNANLKQRSSWLNEQRFAALHFI-GP--G------TNLTVGLADEHEWHGGTS-IA--Q
  435 AHNTSLKKRSSWLNEQRFSALHFT-GP--G------TDLIVGLADEHEWQGGAS-IA--Q
  436 VHNENLKKRSSWLNEQRFFALHFT-GP--G------TDLTVGLADDHEWHGGAS-VA--Q
  437 VHNANLKKRSSWLNQQRFSALHFT-GP--G------TDLTVGLADDHEWHGGAS-VA--Q
  438 VHNATLKQRSSWLNEQRFSALYFT-GP--G------TDLMVGLADDHEWHGGAS-VA--Q
  439 VHNANLKQRSSWLNEQRFSALHFK-GP--G------TDLTVGLADDHEWQGGAS-VA--Q
  440 EHNATLRTRTEWLNEQRFSALHFK-SP--G------TDLIVGLADDHEWHGGAS-EA--Q
  441 EHNATLRTRTEWLNEQRFSALHFK-SP--G------TDLIVGLADDHEWHGGAS-EA--Q
  442 DHNAALKTRSSWLNDQRFTALHFK-SP--G------TDLTVGLADDHEWHGGAS-PA--Q
  443 AHNATLRARTEWLNEQRFAALHFT-GP--G------SDLTVGLADGHEWQGGAS-VA--R
  444 EHNATLMAKRSILTERNFRALRFT-GP--G------TDLKVGLADGHAWMGGIS-TA--R
  445 AHNAALMTRRRMLNEKRFRALHFS-GP--G------TDLTVGLADNHAWMGGSS-KA--A
  446 EHTAALKERVNWLNGQNFAALHYT-GP--G------TDLRLGLADGHIWKGGAS-PA--L
  447 AHTTELQKRVKWLNDHDFAALKYT-GP--G------TDLMLGLADGHIWKGGAS-PA--L
  448 AHNAHLRKRAAWLNERRFAALHFS-GP--D------TDLTVGLADGHAWAGGAE-PA--G
  449 AHNAHLHKRATWLNERRFAALYFT-GP--D------TDLTVGLADGHAWAGGAE-PA--G
  450 AHNARLHRRATWLNDRRFAALHFS-GP--D------TDLTVGLADGHAWAGGAE-PA--G
  451 SHNARLHRRATWLNDRRFAALHFT-GP--D------TDLTVGLADGHAWAGGAE-PA--G
  452 RHNETLHRRAAWLNDRRFAALHFR-GP--D------TDLTVGLADGHAWAGGSE-PA--R
  453 EHNDTLHRRADWLNERRFAALQFT-GP--G------TDLTVGLADGHAWAGGSE-PA--R
  454 AHNARLHARAKYMNDSRFEALHFS-GP--G------TDLTVGLADGHLWAGGSE-KS--G
  455 AHNARLHARAKYMNESRFDALHFT-GP--G------TDLTVGLADGHAWAGGSE-EA--G
  456 AHNAVLHRRAAFLNDARYSALHFK-GP--G------TDLMVGLADGHEWAAGAE-KA--G
  457 AHNAVLHRRAAFLNDARYSALHFK-GP--G------TDLMVGLADGHEWAAGAE-KA--G
  458 AHNAVLHRRATFLNNARYSALHFK-GP--G------TDLMVGLADGHEWAAGAE-KA--G
  459 EHNATLHRRAAFLNDARYAALHFT-GP--G------TDLTVGLADGHDWAGGSE-KA--G
  460 IHNKNLRERTEWLNTKNFEALHFY-TD--G------TDLTVGLADGHEWMGGAS-IA--R
  461 EHDAKLHQRADYLNKKRYHALHFR-GP--G------TDLTVGLADDHLWLGGGT-QA--H
  462 KHDDGLQKRAAYMNEKRYAALQYR-GP--G------TDFRLGLSDGHLWMGGGT-TA--G
  463 AHSANIHQRVAYLNEKRYHSLRFH-SADGK------TDLTVGLADDHLWAGGGG-ES--G
  464 NHGANIHKRVKLLNDKRYHTLHFK-GP--G------TDLKVGLADDHLWAGGGG-VG--G
  465 EHGANLKKRVDFLNDKRFHSLRFY-TPDGT------TDLTVGLADQHLWAGGGT-TA--G
  466 EHNNFLHKKSQWLTQKDFAEIRFS-GP--N------TCLKVGLADGHQWSGGAS-SA--R
  467 EHNNFLHQKSQWLSQRDFAEIRFS-GP--N------TSLKVGLAEGHRWSGGSS-IA--Q
  468 EHNNFLHQKSQWLSQRDFAEIRFS-GP--N------TSLKVGLAEGHRWSGGSS-IA--Q
  469 AHLDGLERRVQQLNAKRYAALHFR-GP--G------TDLRVGLADGHLWAGGAG-RA--Q
  470 THLANLKRRRDLLTSKQYAALHFQGGG---------TDLTVGLADDHIWGGGAA-DT--P
  471 THLANLKARRERLTEKGYAALHFRGGD---------TDLTVGLADDHIWGGGAA-DT--P
  472 AHLADLKRRRELLTEKQYAALHFKGGE---------TDLTVGLADDHIWGGGAA-QT--P
  473 EHLANLKRRREILTGKQYHALHFRGGD---------TDLTVGLADDHIWGGGAA-DT--P
  474 EHLGNLKARREKLTAKQYAAVRFRGGG---------TDLTVGLADDHIWGAGSA-LT--P
  475 DHLTALKTRRDYLTAKGYAALHFKDSE-GG------TDLTVGLADGHVWGGGAS-TSTAP
  476 AHLAALQRRREHLNARRYRALRYR-GP--G------TDLTLGLADGHIWKGGAS-QS--A
  477 AHLAGLERLTRLLTEKQYAAVHLKSEL--G------TDLTVGLAENHIWQGGAE-TA--K
  478 THLTELERLTTLLTEKQYAAVHLKSEL--G------TDLTVGLAEGHIWQGGAE-TA--R
  479 THLSRLEHLTEYLNEKQYTALHLRSGL--G------TDLTVGLAEGHIWQGGAE-TA--K
  480 DHVAALARRSAHLNDKQYAAVHLTTEL--G------TDLTVGLAERHIWQGGAE-EA--K
  481 AHTDRLARLSAYLNEQQFDAVHFRSAE--G------TDLTVGLADGHIWDGGAM-TG--P
  482 AHLKQLARVRDHLNGRRYAALQFT-GP--G------TDLTVGLADGHVWAGGAW-AA--Q
  483 DHVAGLEARAAALNRARFAALIFE-GP--G------TELRVGLAERHVWKSAVA-KA--Q
  484 DHLAVLETRCQGLQALDLSALHFV-GG--G------TDLRVGLAEGHQWVGGRS-RA--A
  485 EHVDTLNKRATLLNEKYFRYLHFI-SE--E------TNLKIELPQNHRWVNGLE-TN--D
  486 ELNRRLKSVAAFLQRNQVQTLHFV-DPVPGPDGKPATDLYVGLAEGARWVGGAA-QT--P
  487 EHRASFDKRVHILNHLDIESVHYTNSL--G------TDLVVELPEGYVFAGGGS-FL--D
  488 ARAVELQASAARLNAHGFDAIRLQ-GP--G------TDLTVGLLPSSRFIAAGM-DT--I
  489 ERQAQLAAVSTRLTARRFDAVHFS-GP--G------TDLRVGLLPRSPWLTVAF-ET--V
  490 DHGKKLHQRCEILNKLKLEKMIFK-NK--K------TNLEIYLLENSIWTGGSE-KV--K
  491 DHGKKLHQRCKILNKLKLEKIIFK-NQ--K------TNLEIYLLESSIWTGGSE-KI--R
  492 IHGNKLHQRCKTLNNLQLEKLIFK-NK--K------TNLEIYLLEHSIWTGGSE-KI--S
  493 IHGNKLHQRCKTLNNLQLEKIIFK-NK--K------TNLEIYLLEHSIWTGGSE-KI--S
  494 IHGNKLHQRCKTLNNLQLEKLIFK-NK--K------TNLEIYLLEHSIWTGGSE-KI--S
  495 SHGEKLHKRCKILNELNLEKLIFK-NE--K------TNLEVYLLETSLWTGGSE-KI--K
  496 SHGKKLHKRCEILNELNLEKVIFK-NE--K------TNLEVYLLETSLWTGGSE-KV--K
  497 FHGERLHKRCKILNELNLEKVIFK-NE--K------TNLEVYLLETSLWTGGSE-KI--K
  498 SHGEKLHKRCKTLNELNLEKVIFK-TE--K------TNLEVHLLETSLWTGGSE-KI--K
  499 SHGEKLHKRCKILNELNLKKVIFK-TE--K------TNLEVYLLETSLWTGGSE-KI--K
  500 SHGEKLHKRCKTLNELNLEKVIFK-NE--K------TNLEVYLLETSLWTGGSE-KV--K
  501 SHGKKLHKRCKILNELNLEKVIFK-NE--K------TNLEVYLLETSLWTGGSE-KI--K
  502 RHGQDLIQRCRTLDSLQLASLRFT-SP--G------TDLTVGLNRRSRWKGGPA-ST--P
  503 EHDRKIKERQQKLNSLHIDSLHFK-SP--V------TDFTIGFDSHSRFIGGSE-NL--P
  504 QKKAMLDRRRGYLNEQGIEELHFKSSK---------TDLTIGFTNQARFTGGAE-SM--Q
  505 QKDIFLKKRIAILNEMEVDSLHFSSPV---------TDLVIGFNEKHRWLGGSS-ML--S
  506 QRIDNIQKQVIYLNQQQFKSLSFTTEK---------SHLNVELVDNHAWVGGCE-IT--D
  507 RRINEIQERVKYLDQQQFKSLYFKTDK---------TQLYVELAENHKWTGGCE-IT--E
  508 EIGKRQQRIAEFLN--KAREIRYV-GP-G-------IDLYLRV-DGRTWIND--------
  509 EIGKRQQRIAEFLN--KAREIRYV-GP-G-------IDLYLRV-DGRTWIND--------
  510 RIGERQSKIVGFLN--KAKEIKYT-GP-G-------IDLYLRV-DGRTWVND--------
  511 EIREKQQKIADFLN--KVSELKYE-GP-G-------IDLFLRV-EGRKWIND--------
  512 EIKEKQQRIADFLN--NVSELKYE-GP-G-------IDLVLRV-EGRKWIND--------
  513 RIGQELSKIAEFLN--KVKELRFE-GP-G-------INLSLSV-EGRKWISD--------
  514 EKAREQQKIVDMLN--RVSELHIK-GP-G-------IDFKVSV-AGRKWIND--------
  515 KQALMQEKITKLLN--KVDELLVL-SD-D-------TELFMKF-AGRTWISD--------
  516 EQGKRQERIVQFLN--RVDELRFI-AD-D-------TDLFVKV-GGRIWIND--------
  517 RQAEWQEKVAALLS--KASELRVV-SS-G-------TDITFRV-EGRIWIND--------
  518 ALSREQQGIVDHLN--ACSQIHYK-GE-G-------IDIQFST-AGRKWINS--------
  519 KFGKELERIASVLN--QKNELHFI-AE-D-------TDLKCKV-GGRTWVAD--------
  520 EFGERLEKIAQFLE--SKSELHFV-SE-D-------TDIKCRV-DGRKWVAD--------
  521 EVSEYQEKIVKLLS--GTKELRIT-GK-N-------TDLTLNV-GGRKWINC--------
  522 KVSEFQDKIVDLLT--GKKELVIK-GF-K-------TELKLNV-DGRKWINC--------
  523 EVDEFQNKVVDILT--GTKEIRIE-GK-N-------TDITFNV-EGRKWINC--------
  524 AVDEYQQKITGLLN--GTKELRIV-GN-K-------TDITFNV-DGRKWINC--------
  525 NLNTRQQKVVDWLK--GKKQVHIK-AK-E-------TDLRLSI-EGRTFVSC--------
  526 NLNKRQQKVVDWLK--GKKQVHIK-AK-D-------TDLHLSI-EGRKFISC--------
  527 NLNTRQQKVVNWLK--GKKQVHIK-AK-E-------TDLRLSI-EGRKFISC--------
  528 NLNARQQKVVNWLK--GKKQVHIK-AK-E-------TDLRLSI-EGRKFISC--------
  529 NLNARQQKVVNWLK--GKKQVHIK-AK-E-------TDLRLSI-EGRKFISC--------
  530 GQSRKLQKVIDWLA--GRREVRIT-AP-E-------TDLTLSI-EGRSFVKC--------
  531 EVGRQQQKFISAFQ--GHDRVTLR-GT-N-------VDLTLSI-RERRFLNS--------
  532 SLQTRQQKAIDWLA--DKSQVVLR-GP-N-------VDLTLCI-RGRRFINS--------
  533 ELSKRQHGQVDWLK--GHKKVHVV-GE-G-------TDLTLSI-EDRIFINS--------
  534 ELHDMQAHLINYLQ--NKREVHIL-GE-G-------TDIRVGI-AGRSFVNC--------
  535 EVSHRQQRLVEFLN--GVKEMRVV-GD-G-------TDLTVSV-AGRTWINA--------
  536 AVSRRQQRLVAFLN--GVREIRVV-GD-G-------TDLTLSV-AGRTWINA--------
  537 RTLEEQQQIADFLN--TCSVIRLV-AP-D-------TDLTYRV-AGRTWINC--------
  538 KTAAEQQRIADLLN--ECSVIRLV-AP-D-------TDLTYRV-AGRTWINC--------
  539 EQSREQARIIDWLA--DKREIHVR-AP-D-------TDLRLSI-AGRRFVNA--------
  540 EQAREQARLIAWLA--DKREVHVR-AP-D-------TDLRLSI-AGRRFVSA--------
  541 DLAAYQQRLIDWLT--PRHEVHVV-GP-D-------TDLRLRI-SGRTWINS--------
  542 QISKKQQEIVKLLE--SHDEIHIV-GN-D-------IDLRYRV-GGRKWISA--------
  543 ELATFQAALIERLR--KVREIRLE-AK-G-------TDLRLNV-EGRTWVNS--------
  544 ELSAFQDRLIARLA--EAREIRVV-AP-G-------TDIRLGV-AGRTWINS--------
  545 ELSRFQEGLIRRLS--AAKELRIL-AP-G-------TDLRLSV-AGRTWVNS--------
  546 ELAAFQEGLIRRLS--RGKTLRIL-AP-G-------TDLTLSV-AGRTWVNS--------
  547 ALSRFQEALIGRLS--QGRELRIQ-AP-G-------TDLRLSV-AGRRWINS--------
  548 ELSAFQAALIERLH--KVKEIRIQ-AD-E-------TDLRLSV-EGRTWINS--------
  549 ELGTFQAELIERLR--GARQLRIE-AD-G-------TDLVLDV-GGRTWVNS--------
  550 ALSEAQARLIRRLE--GVRELRIR-AE-G-------TDLRMRV-EGRRWVNS--------
  551 EVRARQARLIERLA--RADTVRIE-AP-G-------TDLTLRV-GGRNWANS--------
  552 EVRQMQARIIDRLT--RADVVRIE-AP-G-------TDLTLRV-GGRTWANS--------
  553 EVRELQARLIERLS--RADVVRIE-AP-G-------TDLTLRV-GGRIWSNS--------
  554 EVREMQAGLIERLQ--TADQLRIQ-NA-G-------TDLTFSV-KGRTWANS--------
  555 EVRAMQARLIERLT--VADEVRIV-GP-G-------TDLRLSV-RGRTWANS--------
  556 ELREQQAALIERLS--RADEVRII-GD-G-------TDLRLRV-GGRRWVNS--------
  557 EKSRRQERLKERLE--RAREIRIT-GP-E-------TDLTLSV-EGRTFVNS--------
  558 DLGRRQAGLIKFMT--GARTVRIE-GD-D-------TDLTFSV-AGRTWINS--------
  559 ELGRRQAGLIAFMA--GVKTIRIE-AE-G-------TDLTLSV-AGRTWINS--------
  560 TIHQQQQKVTHFLN--SCRSIRIE-GP-D-------VDLSYRC-EDRIWINC--------
  561 KVEAEQQKIIDYLS--DKHELRFR-NPMG-------TDLRVNI-SGMKWVNC--------
  562 AVREHQAQMVEILD--PAEEVRIV-SG-ET------TDVTMSI-AGNETLND--------
  563 AVREHQAQMVEILD--PADEVRIV-SG-ET------TDVTMSV-TGNETLND--------
  564 AVREHQSQMVDILD--PADEVRIV-SG-DT------TDVTMSV-AGNPTLND--------
  565 DQRDHQENMVEILD--PADEVRIV-SG-DT------TDVTMSV-DGNPTLND--------
  566 EQREHQEHMVEIMD--PADEIRIK-SG-DT------TDVTMSI-AGNPTLND--------
  567 DQRELQANMVEILD--PAEEVRIV-SG-DT------TDVTMSV-AGNPTIND--------
  568 AQREFQDQMVEILD--PAEEVRIV-SG-EG------TDVTMSV-AGNTTLND--------
  569 AQRRHQEQMVEILD--PASEVRIK-SG-DT------TDVTMSL-DGMKTLND--------
  570 EQREFQAQMVDILE--EASEVRIK-SG-DT------TDVTMSV-AGNHVLND--------
  571 EQREFQAQLVEILE--DASEVRIA-SG-DT------TDVTMSV-DGNHVIND--------
  572 EQREFQQQMVELLD--PADEVRIV-SG-DT------TDLTMSV-SGMKTIND--------
  573 EQYEFQQQMVEILD--DADEVHIV-AG-DE------TDVTMSV-AGNSTLND--------
  574 AQREHQSQLVDILA--DADEVRIQ-SG-SN------TDVTMRI-AGNTALND--------
  575 AQGELQQQLVDILN--DGDEVRIT-SG-DE------TDVTMSI-AGNTAIND--------
  576 EQREFQSNMVEILD--TADEVRIT-SG-EE------TDLTMDL-SGNSTLND--------
  577 AQRERQSNLVDILN--EGSEVRIR-AG-KE------TDVTMSI-EGNTAAND--------
  578 AVEDHQQQMVDILN--PAEEVRIV-SG-DT------TDVTMSV-ADMTTLND--------
  579 AVEEHQEQMVEILD--GADQVHIV-SG-DE------TDVTMSV-KNMITLND--------
  580 AVEEYQEELRRRLE--EARTVRVV-AG-E-------TDIEMSV-EHMHAINS--------
  581 SLAAEMDRLKTILD--SGTEVHID-AP-G-------TDLTLSI-EGRTAVNSAA-SV--A
  582 SLSEEMDRLKTILD--QGDEVHID-AP-G-------TDLTLSI-AGRTAVNSAA-SV--A
  583 SLAEEMDQLKTLLD--EGREVHLL-GE-G-------TDLTMSI-ADRVAVNSAA-SV--A
  584 ALADEQARLKEILD--DGSEVRIV-AD-G-------TDITLFI-DGRIAVNSAA-SV--A
  585 ALAEEQAQLKDILD--DGKEVRIV-AD-G-------TDITLYI-DGRIAVNSAA-SV--A
  586 ALADRMANMKTILD--EGSEVRLV-TE-D-------TDLTMRI-AGRQAVNSAA-SV--A
  587 SLADEMANMKDVLD--AGSEVRVV-KA-D-------TDLTMSI-ENRVAVNSAA-SV--A
  588 SLAEEMAQMKDLLD--AGDEVRLV-SS-G-------TDLTMRI-DDRTAVNSAA-SV--A
  589 SLADEMAQLKDLLD--AGSEVRLV-SS-D-------TDLTMSI-EGRTAVNSAA-SV--A
  590 SLADEMANMKDLLD--AGSEVRLV-SD-G-------TDLTMAI-DDRTAVNSAA-SV--A
  591 SLADEMANMKDLLD--EGSEVRLV-SE-G-------TDLTMSI-EGRTAVNSAA-SV--A
  592 SLAEEMARMKELLD--EGAEVRLV-SE-G-------TDLTMQI-GDRTAVNSAA-SV--A
  593 ELADQMANMKEILD--EGSEVRLV-KG-DN------TDIRMSI-EGRTAVNSAA-SV--A
  594 ELAEEMANMKDVLD--AGSEVRIV-KA-D-------TDLTMSI-EGRTAVNSAA-SV--A
  595 SLADEMATMKTLLD--EGSEVRIV-KE-D-------TDLTMSV-EERTAVNSCA-TV--G
  596 TLAEEMERLKRCLD--DGSELRVV-SDNGE------TDLTMSI-EHRTAVNSAA-SV--A
  597 QISKKWNDCVKILN--KGKHVRLA-GK-R-------TDLSFSV-EGRSWSVD--------
  598 EENKRWDTVVTQLN--KSRWVRIV-GK-D-------TDLTFSV-EGRKWIPF--------
  599 DAGRRMQALCDRLA--GARMAVIE-DEWG--------VLELGL-ESRTWVPF--------
  600 KMAKAMQPLKELME--RTDRVKIT-GP-G-------TELTFSI-KGIPAIPC--------
  601 RMGKGMKPLVERME--KTDRVHIK-GP-G-------TDLTFSI-KGLPAIPC--------
  602 KMDRAQDPLQALMS--RTDKVRIV-SP-G-------TDLTFSI-KGIGAKKC--------
  603 KMDRAQDPLAELMR--NTDKVRIV-GP-G-------TDLSFSI-KNIGAEKC--------
  604 KMSLAMDPLQALMN--RTDRVRIV-GP-GA------TDISFSI-KGIGSVKC--------
  605 KMEKAMDPLVELME--RTNKVRII-SP-G-------TDLTFSI-KGIPAIKC--------
  606 KMSAAMTPLKELME--RTDRVRIV-GP-K-------TDLRFSI-KGINAIKC--------
  607 KMSQAMTPLVELMN--KTDKVRIV-GT-G-------TDLTFSI-KSLPAIKC--------
  608 KMSKAMDPLVELIE--KTDRVRIL-GP-A-------TDLNFSI-KTLPGIKC--------
  609 KMSKAMDPLVELIN--RTDKVRLT-GV-G-------TDLTFSI-KSLPGIKC--------
  610 KMSKAMDPLVKIME--STDKVRIT-GK-G-------TDLTFSI-KGLPAIKC--------
  611 RMGRAMDPLVALLE--KTDKVRII-GP-G-------TDLTFSI-KGIGAVKC--------
  612 KMSKAMDPLVELMN--RTKKVRIV-GP-G-------TDLEFSI-EGINAIKC--------
  613 KMSKAMDPLKELMA--KTDRVKII-GP-G-------TDLAFSI-KGMPAIKC--------
  614 KMSVAMDPLKALME--KTDRVHIV-GP-G-------TDLEFSI-KGMPAIKC--------
  615 KMSLAMDPLVQLME--RTDKVRIT-GP-G-------TDLTFSI-KGMKGIKC--------
  616 NMDKAMDALVTLLE--KTDQVHIV-GE-G-------TDLRFSI-QGMGNVKC--------
  617 KMDKAMDSLVELME--KTDKVRIV-GP-G-------TDLTFSI-KDIPAIKC--------
  618 KMDKAMDSLVDLMN--RTDKVRLV-GP-E-------TDLTFSI-KDIPAVKC--------
  619 KMSHAMDALVALMN--RTDKVQIK-GP-G-------TDLTFSI-KGIPAVKC--------
  620 KMDKAMDSLVALFD--KTDRVHIK-GP-G-------TDLTFSV-KGVPSIKC--------
  621 KMDKAMDSLVELMD--KTDKVRLT-GP-G-------TDLTFSI-KDIPAIKC--------
  622 KMDKAMDALVELMN--KTDQVRIT-GP-G-------TDLTFSI-KDIPAVKC--------
  623 KMSKAMDALVELMN--RTDKVRLT-GE-N-------TDLTFSI-KDIPAVKC--------
  624 KMDKAMDSLVDLMN--KTDKVRIT-GE-G-------TDLTFSI-KDIPAVKC--------
  625 KMDKAMDSLVTLMN--KTDKVRLT-GP-G-------TDLTFSI-KDIPAIKC--------
  626 KMDKAMDSLVTLMN--KTDKVRLT-GP-G-------TDLTFSI-KDIPAIKC--------
  627 KMDKAMDSLVTLMN--KTDKVRLT-GP-G-------TDLTFSI-KDIPAIKC--------
  628 KMDKAMDSLVTLMN--KTDKVRLT-GP-G-------TDLTFSI-KDIPAIKC--------
  629 KMDKAMDSLVELMN--KTDKVRLT-GP-G-------TDLTFSI-KDIPAIKC--------
  630 KMSTAMDGLVALMN--KTDKVHLV-GP-G-------TDLTFSI-KDIPAIKC--------
  631 KISTAMDGLVELMN--KTDKVHLV-GP-G-------TDLTFSI-KDIPAIKC--------
  632 KMSTAMDGLVELMN--KTDKVHLV-GP-G-------TDLTFSI-KDIPAIKC--------
  633 KMSTAMDGLVELMN--KTDKVQLI-GP-G-------TDLTFSI-KDIPAIKC--------
  634 KMSDAMDGLVELMN--KTDKVHLV-GP-G-------TDLTFSI-KDIPAIKC--------
  635 KMGEAMTPLVDLMN--RTDRVRLV-GP-G-------TDLSFSI-KDIPAIKC--------
  636 KMDRAMDGLVELMN--KTDRVTLK-GP-G-------TDLSFSI-KDIPAIKC--------
  637 KMDRAMDALVERMN--RTDQVRIT-GE-G-------TDLTFSI-QDIPAIKC--------
  638 KMDNAMDALVKRMN--NTDQVRIT-GE-G-------TDLTFSI-KDIPAIKC--------
  639 KMAKAMEPLVKYME--KTDKVRIT-GP-G-------TDLTFSI-KDIPVVPC--------
  640 KMSKAMDALVELMQ--NTDEVRIV-AK-D-------TDLRFSI-KGMKAVKC--------
  641 KMSKAMDALVELMQ--NTDEVRIV-AK-D-------TDLRFSI-KGMKAVKC--------
  642 KMSKAMDALVELMQ--NTDEVRIV-AK-D-------TDLRFSI-KGMKAVKC--------
  643 KMSKAMDALVELMQ--NTDEVRIV-AK-D-------TDLRFSI-KGMKAVKC--------
  644 KMSKAMDALVELMQ--NTDEVRIV-AK-D-------TDLRFSI-KGMKAVKC--------
  645 KMSKAMDALVELMQ--NTDEVRIV-AK-D-------TDLRFSI-KGMKAVKC--------
  646 KMSRAMDKLVELME--KTDEVRIV-GE-G-------TDLTFSI-KGMKAVKC--------
  647 KMSKAMDALIDLMN--KTDKVRIT-GP-G-------TDITFSI-KGIPAVKC--------
  648 KMSKAMDNLVKLMN--KTDKVRIV-GK-G-------TDLTFSI-KDIPAIKC--------
  649 KMSKAMDSLVSLMN--KTDKVRIV-GN-G-------TDLTFSI-KNIPAIKC--------
  650 KMSAAMDRLAALMK--KTDTVRVT-GP-G-------TDISFSI-KGLPPVKC--------
  651 KMAKAVEPLKELME--KTDKVRIK-GP-G-------TDLTFSI-KGMNAIPC--------
  652 KMQRAALALVDLMN--RTDKVRLV-AQ-D-------TDITFSI-KDIPAVPC--------
  653 RMIEGMAALEDLMS--QTDQVELK-GP-G-------CDLRFSI-KDIGAVAC--------
  654 RMTPGMNALKALME--KTDRVEIK-GP-G-------TDLTFSI-KGIKACPC--------
  655 RMKAGSDALAALMR--QTDKVHIK-GA-G-------TDIKFSI-KNIGAVAC--------
  656 KMQPGMKALKAAME--STDKVEIK-GP-G-------TDLRFSI-KGIQAIPC--------
  657 KMAKAMAPLEKRMK--KADHVHLK-SP-G-------TDLTFSI-KGIGAKMC--------
  658 RMEEAQKPLQRRLG--QTERVRIV-SP-G-------TDLSFSI-KNIPVVPC--------
  659 KMAEACQPLYDLMD--KTDKVRIV-GP-G-------TDLTFSI-KGIGTRTA--------
  660 KMHEAFLPLQQLMD--RTDKVRLV-GP-G-------TDLQFSI-KDIPSVIC--------
  661 AMSRAMDRAEEFLS--LAKSVHIT-GP-G-------TDLRFSI-EGLPAVKC--------
  662 DMARRFTEAKPFLD--AVDKVRII-AP-G-------TDLSFSV-KGLGWIPC--------
  663 ALRPAMRKLAAMME--KAEYVKIT-GP-G-------TDISFSI-KGLPAIPC--------
  664 RMARALEPLARRMR--DADEARVL-GP-G-------TDLRFSI-KGMPVVSC--------
  665 KMSKAMDPLVTLMD--RTEKVRIL-AQ-G-------TDLSFSI-KDMPAIKC--------
  666 QESRKQEKLKKLMD--GTSRVRIT-AP-D-------TDLSFSI-GGMPGVKC--------
  667 IESKKMEKLKKLMD--KTDKVRLK-GP-D-------TDLAFSI-KGLQGIKC--------
  668 AESRKQEKLKKLMD--KADRVKIK-AS-D-------TDLTFSI-KGLPGIKC--------
  669 AESLKQDKLKKLVD--AADKVRIK-AS-D-------TDLFFSI-KGLPGIKC--------
  670 AESRKQEKLKRLMD--KADTVRIK-AS-D-------TDLSFSI-RGLDGIKC--------
  671 EESRKQDALKACVD--AADRVRIK-AS-D-------TDLCFSI-KGLPGIKC--------
  672 EESRKQDALKACVD--AADRVRIK-AS-D-------TDLSFSI-KGLPGIKC--------
  673 AISDAHLKLIQEFN--IATHVRIT-NN-DG------TDVSMEL------VDD--------
  674 RIYEQAGRIKSWLNSLDVDSFHVQ-S--AH------CDLTVTPGQDRQWVGI--------
  675 DIFEQSKRIKEWLDSMDVEYFHVL-S--KN------TDLKVYPGEKRRWVGL--------
  676 TLYEEAREIKAWLNSIKAVSLRVE-S--DN------VDLTVTPGRHRRWLGL--------
  677 TLYEEAREIKAWLNSIKAVAFRVE-S--DN------VDLTVTPGRHRRWLGL--------
  678 KLYEDAREIKAWLDGMKASYLHIE-S--DN------VDLKVTPGEHRRWLGL--------
  679 ALYEEVREIKAWLGSIKADYLHVE-S--VG------VDLKVSIGERRRWLGL--------
  680 EIFAEAEKVKAWLNGLDIKSLRVT-S--EN------TDLTVTPGRDRRWLGV--------
  681 EIFAEAEKVKAWLNALSIEHLRIQ-S--KD------TDLIVVPGEQRRWLGV--------
  682 GVFDKASEVKNWLNGLGIESYRVV-T--DD------MDLTVKHGELRQWIGV--------
  683 EIFREAHGVKEWLNGMDVEYYHVQ-S--AS------TDLKIHPGESRCWIGI--------
  684 QFWNAAQEIKAKLNSLDIESYHIE-S--ER------TDLRVVGGLMRRWVGI--------
  685 KVYQDAARIKKWLNSMSVKTFHIE-S--EN------TDLEITPGDQRKWIGI--------
  686 TIFQKAAAIKKWLNSMEIKVLHIA-S--EH------TDLEITPGKKRKWVGI--------
  687 KLFNRATSLKAWLNGMDVDYYQVK-S--AN------TDLKVDPGEKRRWIGI--------
  688 AIYREVGEIKAWLNSLPVRSFLIV-S--QN------VDLRITPGEKRKWIGI--------
  689 RMARQAEGIRTKLDELGDATLHVE-A--DG------TDLRLRVGRMRRWAGV--------
  690 RVARQAEEIRAKLDELGDADLHVE-A--EG------TDLRLRVGRQRRWAGV--------
  691 RIAKEAEALRTALDALGDVVLHVE-SD-DG------TDLRLSVGQQRRWAGV--------
  692 MLARHAEDIRNWLNSMDMVSLRTE-S--DS------VDLLVTLGERRVWAGI--------
  693 ALYRELYDYKDKLDALQIEKVHIE-A--DN------TDLWVQLGDHRKWLGG--------
  694 GMLELTNKIADVLD--KGKEVHIL-TPLG-------TDLKFSI-EGRKARRSTGIYRNPG
  695 EVDRISQQVWQLAS--TARVIRAT-NPAG-------TDITGKFSPGLKWLKTSGIISPHK

             24               25            26        27         2
      8A9ABCDE01234ABCDEFG56789012345ABCD678901234567890123A456789
                               #                                  
                                                                  
    1 S-G-----VRFIA-------NMPTEEVFTMP----DYRKAEGKVVSSRPLSYR-GNLIKD
    2 S-G-----VRFIA-------NMPTEEVFTMP----DCRKAEGKVVSSRPLSYR-GNLIKD
    3 E-Q-----IYFFA-------NMPTEEIFTAP----DRNRAEGKLVSSLPLSYQ-GNIIEH
    4 D-G-----IAFFP-------NIPTEEIFSAP----DKTRVNGTLAASHPLVYN-GQLIDH
    5 D-G-----VEFFP-------NIPTEEVFSAP----HKDKVNGTLVSSHPLVYN-GQLIDN
    6 E-G-----IEFIA-------NMPTEEVFTLP----KKTGVNGKVVSSLPLNYN-GNLIEN
    7 D-G-----IEFIA-------NMPTEEVFTLP----HKTGVNGKVVSSMPLNYN-GNLIEN
    8 E-G-----IEFIA-------NMPTEEVFTLP----KKTGVKGKVVSSMPLNYN-GNLIEN
    9 D-G-----LEFIA-------NMPTEEVFTLP----KKNGVNGKVVSSMPLNYN-GNLIEQ
   10 D-G-----VEFVA-------NMPTEEVFTLP----KKTGVNGKVFSSMPLNYN-GTLIDD
   11 E-G-----LEFIA-------NMPTEEVFTLP----KKTGVNGKAVSSMPLNHN-GNLIKN
   12 E-G-----LEFIA-------NMPTEEVFTLP----KKTGVNGKVVSSMPLNHN-GNLIKN
   13 E-G-----IEFIA-------NMPTEEVFTLP----KKTGVNGKVVSSLPLNYN-GNLIKN
   14 G-G-----IEFIA-------NMPTEEVFTLP----KKDGANGRVVSSKPLNYN-GTVIDK
   15 E-G-----TEFMA-------NIPTEEVFTLP----YKFGVNGKVTSSKPLNYN-GNLIEN
   16 E-G-----VEFMA-------NIPTEEVYTFP----LKWGVNGKVVSSKPLNYN-GNLIEN
   17 K-DSEFPETEFIA-------NMPTEEVFSMP----KKTGVNGIVYSSKPLNYR-GTLIDQ
   18 E-G-----IEFIA-------NMPTEEVFTLP----LKTGANGTVVASKPLNCN-GTIVED
   19 G-G-----VEFIA-------NMPTEEVFSMP----SKFGVNGTVFSSKPLNYG-GNLIDN
   20 E-G-----VYFVA-------NMPTEEIFTLP----KKDEVNGIVYSSKPFSYG-GNLIEN
   21 E-G-----VYFVA-------NMPTEEIFTLP----KKDEVNGIVYSSKPFSYG-GNLIEN
   22 E-G-----VYFVA-------NMPTEEIFTLP----KKDEVNGIVYSSKPFSYS-GNLIEN
   23 S-G-----IDFIA-------NIPTEEIFTMP----HREKVNGTLVSSKPFIYG-GSTIIH
   24 N-K-----RYFVA-------NMPTEEVFTLP----LKTGVNGIVKSTKPLNYS-GNLINN
   25 N-K-----RYFVA-------NMPTEEVFTLP----LKTGVNGIVKSTKPLNYS-GNLINN
   26 S-N-----VYFVA-------NMPTEEVYTMP----LKTGVNGYLTSTFPLNYS-GNLINN
   27 D-G-----VRFVA-------NMPTEEVFTLP----KRDGVNGYVTSKKPLNYG-GNLIDN
   28 D-G-----INFVA-------NIPTEEVFTLP----KRDGVNGYVTSKKPLNYG-GNLIDN
   29 L-G-----TVFAA-------NMPTEEVYTLP----KRDGVNGIVYATKPLNFN-GNLIED
   30 L-G-----TVFVA-------NMPTEEVFSLP----KRDGVNGTVVASKPLNYN-GNLIEG
   31 D-G-----VTFVA-------NMPTEEIYTLP----KRDGVNGTVRAMRPLNVN-GNLVEG
   32 E-G-----TLFAA-------NLPTEEVYTLP----KRDGVNGTVVASKPLHYN-GNLISG
   33 A-G-----TVFAA-------NLPTEEVYTLP----KRDGVNGTVVASKPLHYN-GNLISG
   34 S-G-----TMFVA-------NIPTEEVYTLP----KRDGVNGVVVASKPLHYN-GNLISG
   35 S-G-----TMFVA-------NIPTEEVYTLP----KRDGVNGVVVASKPLHYN-GNLISG
   36 A-G-----HLFAA-------NIPTEEVYTLP----QRNGVNGIVAASKPLHYN-GTLIHD
   37 A-G-----HLFAA-------NIPTEEVYTLP----QRNGVNGIVAASKPLHYN-GTLIHD
   38 D-G-----VLFAA-------NMPTEEVYTLP----HRGGVNGTVAASKPLHFN-GNVIYD
   39 D-G-----VLFAA-------NMPTEEVYTLP----QRGGVNGTVAASKPLHFN-GNVIYD
   40 D-G-----LRFIA-------NMPTEEVYTTP----KLDDVNGIVFSSKPLSYC-GNLINN
   41 N-G-----VEFIA-------NMPTEEVFTTP----KLDGVNGTVYSSKPLSYC-GNLINN
   42 NGG-----FDFIA-------NMPTEEVFSTP----KYDGVNGVVFSSKPLSYC-GNIIND
   43 S-G-----IEFNA-------NMPTEEVYTLP----KKHGINGTVTSSKPLSYG-GNLINN
   44 K-G-----TYFVA-------NMPTEEIFTMP----HKYGVNGTLKATKPLVFG-GNLIED
   45 T-G-----QTYIA-------NIPTEELFTSP----LKTGVNGVVYASMPLVND-GNIIDK
   46 Q-G-----RYFVP-------NLPTEEVFTMP----LKEGINGIVQSTKPLSYG-GNLLEN
   47 Q-G-----IHFVP-------NLPTEEVFTIP----VRNSVNGTVSSTKPLNYS-GNLINN
   48 Q-G-----IPFQP-------NMPTEEVFTLP----LKKGVNGTVASTKPLNFG-GNLINK
   49 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLVFA-GNIIDN
   50 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLVFA-GNIIDN
   51 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   52 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   53 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   54 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   55 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   56 K-D-----VPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDH
   57 K-N-----VAFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   58 K-N-----VAFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   59 K-N-----VAFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLAFA-GNIIDN
   60 K-N-----IPFMA-------NIPTEEVFTMP----LKTGVNGQVSSTKPLVFA-GNIIDN
   61 K-N-----VPFMA-------NIPTEEVFTMP----LKTGVNGYVSNTKPFVFS-GNIIDN
   62 D-G-----NSFMA-------NMPTEEVFTLP----KKDGVNGQVTSTKPLSYA-GNLIEN
   63 S-G-----HEFMA-------NMPTEEVFTLP----QKDGVDGVVSSTKPLSYG-GNIIEN
   64 S-G-----HEFMA-------NMPTEEVFTLP----QKDGVDGVVSSTKPLSYG-GNIIEN
   65 N-G-----NEFMA-------NMPTEEVFTLP----QKDGVNGTVSSTKPLSYG-GNIIDN
   66 S-G-----HEFMA-------NMPTEEVFTLP----QRDGVNGTVSSTKPLSYG-GNIIDN
   67 S-G-----HEFMA-------NMPTEEVFTLP----QRDGVNGTVSSTKPLSYG-GNIIDN
   68 N-G-----VEFMA-------NMPTEEVFTAP----KKDGVNGTVSSTKPLSYG-GNLIDG
   69 N-G-----VEFMA-------NMPTEEVFTAP----KKDGVNGTVSSTKPLSYG-GNLIDG
   70 N-G-----VEFMA-------NMPTEEVFTAP----KKDGVNGTVSSTKPLSYG-GNLIDG
   71 R-G-----VSFMA-------NMPTEEVFTVP----KKDGVNGTVSSTKPLSYA-GNIIDE
   72 K-G-----HEFMA-------NMPTEEVFTVP----LKTGVNGHVSSTKPLSYG-GNIIDN
   73 Q-G-----HEFMA-------NMPTEEVFTVP----YKTGVNGTVSSTKPLSYG-GNIIDK
   74 Q-G-----IEFMA-------NMPTEEVFTVP----LKTGVNGVVSSTKPLSYG-GNIIND
   75 K-G-----IDFMA-------NMPTEEVFTVP----HRNGVNGYVSSTKPLSYS-GNIINN
   76 K-G-----VNFMA-------NMPTEEVFTVP----LKTGVNGTVSSTKPLSYG-GNVIDN
   77 N-G-----VAFMA-------NMPTEEVFTAP----KKTGVNGYVSNTKPLSYG-GNIIDG
   78 D-G-----VSFMA-------NMPTEEVFTAP----LKEGVNGTVRSTKPLSYH-GNLIEN
   79 K-G-----EEFMA-------NMPTEEVFTVP----HKDGVNGYVSSTKPLSYG-GNIIDN
   80 K-G-----DTFMA-------NMPTEEVFTVP----YKTGVNGFVSSTKPLSYG-GNIIDD
   81 H-G-----HEFMA-------NMPTEEVFTAP----LKEGVNGYVSSTKPLSYA-GTIIDR
   82 Q-G-----QTFMA-------NIPTEEIFTAP----LKTGINGFVSSTKPLSYG-GNIINN
   83 Q-G-----QTFMA-------NMPTEEIFTAP----LKTGVNGFVSSTKPLSYG-GNIIDN
   84 Q-G-----QTFMA-------NMPTEEIFTAP----LKTGVNGYVSSTKPLSYG-GNIIDN
   85 K-E-----IPFMA-------NMPTEEVFTVP----QKEGVNGYVSSTKPLSYG-GNLIDN
   86 K-G-----IPFMA-------NMPTEEVFTAP----HKHGTNGYVSSTKPLNYG-GNVIDR
   87 N-H-----VSFMA-------NMPTEEVFTVP----QKTEVNGYVSSTKPLSYG-GNIIDN
   88 N-D-----IPFMA-------NMPTEEVFTVP----YRNGVNGYVSSTKPLSYG-GNIIDN
   89 R-G-----HSFVA-------NMPTEEVFTAP----LKTGVNGTVHSTKPLSYA-GNIINN
   90 R-G-----HSFVA-------NMPTEEVFTAP----LKTGVNGTVHSTKPLSYA-GNIINN
   91 R-G-----HSFVA-------NMPTEEVFTAP----LKTGVNGTVHSTKPLSYA-GNIVDN
   92 R-G-----HSFVA-------NMPTEEVFTAP----LKTGVNGTVASTKPLSYA-GNIVDN
   93 Q-G-----HTFVA-------NMPTEEVFTAP----LKTGVNGKVSSTKPLSYS-GNIIDN
   94 Q-G-----HTFVA-------NMPTEEVFTAP----LKTGVNGKVSSTKPLSYS-GNIIDN
   95 Q-G-----HTFVA-------NMPTEEVFTAP----LKTGVNGKVSSTKPLSYS-GNIIDN
   96 Q-G-----NTFLA-------NLPTEEVFTAP----LKTGVNGTVSATKPLSYR-GTIIDR
   97 K-G-----ISFLA-------NMPTEEVFTAP----RYDGVNGTVSSTKPLSYG-GNLIDN
   98 K-G-----ERFVA-------NIPTEEVFTAP----LKTGVNGTVRSTKPLSYG-GNIIDN
   99 K-G-----ERFVA-------NIPTEEVFTAP----LKTGVNGTVRSTKPLSYG-GNIIDN
  100 K-G-----ERFVA-------NIPTEEVFTAP----LKTGVNGTVRSTKPLSYG-GNIIDN
  101 Q-G-----EHFVA-------NIPTEEVFTAP----LKTGVNGTVRSTKPLSYG-GNIIDN
  102 N-G-----VAFIA-------NMPTEEVFTTP----LKTGVNGTVRSSKPLNYG-GNMIDN
  103 D-G-----VDFVA-------NMPTEEVFTSA----KKTGVNGTVSSTKPLNYG-GTIIDN
  104 D-G-----VDFVA-------NIPTEEVFTAA----KKTGVNGTVTNTKPLNYG-GTLIDQ
  105 A-G-----IDFVA-------NMPTEEVFSAA----KKDGVNGTVISTKPLNYG-GTLITN
  106 D-G-----VHFVA-------NMPTEEVFTAP----KKDGVNGTVTNTKPLNYG-GNTIDD
  107 D-G-----VHFVA-------NMPTEEVFTAP----KADGVNGTVSNTKPLNYG-GNLIDN
  108 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  109 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  110 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  111 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  112 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  113 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  114 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  115 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  116 K-G-----HEFMA-------NMPTEEVFCCA----DKLKVEGYVSSTKPLSYA-GNIIDD
  117 K-G-----HEFMA-------NMPTEEVFCCA----DKYAVSGHVSSTKPLSYG-GNIIDN
  118 K-G-----HEFMA-------NMPTEEVFCCA----EKTSVQGYVSSTKPLSYS-GNVIDN
  119 D-G-----IDFIA-------NMPTEEVFTLA----DKDSVEGHVSSTKPLSYS-GNLIDE
  120 D-G-----VDFIA-------NLPTEEVFTLP----KKTGVNGYVSSTKPLSYS-GNLIDE
  121 S-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGTVRNTKPLNYN-GNVIDG
  122 S-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGTVRNTKPLNYN-GNVIDG
  123 S-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGTVRNTKPLNYN-GNVIDG
  124 S-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGTVRNTKPLNYN-GNVIDG
  125 S-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGTVRNTKPLNYN-GNVIDG
  126 S-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGTVRNTKPLNYN-GNVIDG
  127 S-G-----VRFNP-------NMPTEEVYTMP----HKDGVNGTVRNTKPLNYD-GNVIDG
  128 S-G-----VRFNP-------NMPTEEVYTMP----HKDGVNGTVRNTKPLNYD-GNVIDG
  129 S-G-----IRFNP-------NIPTEEVYTMP----HKDGVNGTVRNTKPLNYN-GNLIDG
  130 S-G-----IRFNP-------NIPTEEVYTMP----HKDGVNGTVRNTKPLNYN-GNLIDG
  131 K-G-----VRFNP-------NIPTEEVFTMP----HKDGVNGKVRNTKPLNYN-GNLIDG
  132 D-G-----IVFNP-------NMPTEEVFTMP----HKDGTNGVVRNTKPLNYG-GNIIDG
  133 K-G-----IFFNP-------NLPTEEVFTMP----RHDGVNGVVRSTKPLNHG-GQLIDG
  134 Q-G-----TEFNP-------NMPTEEVFTMP----HKYGVDGKVTSTKPLNYG-GNLIEN
  135 Q-G-----TTFNP-------NMPTEEVFSLP----HKYHVNGTVASTKPLNYG-GSLIDN
  136 K-G-----ITFNP-------NMPTEEVFSMP----HKYGVNGTVSSTKPLNYG-GSLIDN
  137 S-G-----ISFNP-------NMPTEEVFSLP----HKYGVNGTVSSTKPLNYG-GSLIDN
  138 KEN-----IQFNP-------NMPTEEVFTAP----HKYGVDGKVTCTKPLNYG-GNVIDG
  139 Q-G-----VFFVP-------NIPTEEMFTLP----RADGVNGTVRSTMPLNWN-GTLIDG
  140 Q-G-----NTFNP-------NVPTEEVYTAP----HRNGTHGVVRSTKPLSYQ-GNLIEN
  141 Q-G-----TWFVP-------NLPTEEVYSAP----LRTGVNGTISSTKPLSYN-GNIVDN
  142 E-G-----NVFIA-------NMPTEEVYTLP----MKQGVEGYVSNSKPLVYQ-GNIIDG
  143 E-G-----HVFIA-------NMPTEEVYTLP----MKQGVDGYVSNSKPLVYQ-GNIIDG
  144 E-D-----NVFVA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  145 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  146 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  147 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  148 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  149 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  150 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  151 D-D-----TIFMA-------NMPTEEVYTLP----MKQGVNGYVSNTKPLVYQ-GNIIDG
  152 D-G-----TTFIA-------NMPTEEVFTLP----AKFGVNGYVSNTKPLVYK-GNIIND
  153 Q-G-----NPFIA-------NMPTEEVYTVP----LKQGVEGTVRNTKPLVYQ-GNVIDN
  154 Q-G-----VYFVA-------NMPTEEVYTMP----LRTGVNGTVTSTKPLNLN-GRLVDK
  155 Q-G-----DYFVA-------NMPTEEVFTMP----KRDGVNGTVSSTMPLNLG-GRLVDK
  156 A-G-----VYFVA-------NMPTEEIYTMP----HRTGVNGTVSSTLPLNLN-GRLVEG
  157 A-G-----VYFVA-------NMPTEEIYTMP----HRTGVNGTVSSTLPLNLN-GRLVEG
  158 V-G-----VYFVA-------NMPTEEIYTMP----HRTGVNGTVTSTLPLNLN-GRLVEG
  159 S-G-----VYFVA-------NMPTEEIYTMP----HRTGVNGTVTSTMPLNLN-GRLVEG
  160 R-G-----DYFVA-------NMPTEEVFTMP----KRTGVDGHITSTMPLNLN-GQLVDR
  161 R-G-----DYFVA-------NMPTEEVFTMP----KRTGVNGYVTSTMPLNLN-GQLVDR
  162 R-G-----NYFVA-------NMPTEEVFTMP----KRTGVNGYVTSTMPLNLN-GQLVDR
  163 Q-G-----IYTVA-------NMPTEEVFTMP----KRTGVNGHVTSTMPLNLN-GQLVDR
  164 N-G-----ISFNP-------NIPTEEIFGMP----HKFKVNGTVYSTKPLVYG-GNIIDN
  165 N-G-----IEFNP-------NMPTEEIFCLP----HKYGVNGTLASTKPLVYG-GNVIND
  166 N-G-----VSFVP-------NIPTEEVYGMP----HKFGVNGTVASTKPLVFG-GNVIDD
  167 K-K-----NMFNP-------NIPTEEVFGMP----HKYKVDGIVYSTKPLIYA-GSLIDE
  168 K-G-----NFFNP-------NIPSEEIYGMP----HKYKVDGIVHSTKPLVYA-GSLIED
  169 A-G-----TTFVP-------NIPTEEVYTLP----LKSGVNGTVMATRPLVYG-GKLIEN
  170 S-G-----IMFNA-------NIPTEEVFTMP----HKRGVNGTVSSTKPLNAD-GRIIDG
  171 R-G-----EKFMA-------NMPTEEVFTAP----DSRRIDGYISSTKPLSYA-GTIISG
  172 R-G-----EKFMA-------NMPTEEVFTAP----DSRRIDGYISSTKPLSYA-GTIISG
  173 R-N-----EKFMA-------NMPTEEVFTAP----DNRRIDGYISSTKPLSYA-GTIISG
  174 R-G-----EEFMA-------NMPTEEVFTAP----DSRRVDGYVSSTKPLSYA-GTIISE
  175 R-G-----EEFMA-------NMPTEEVFTAP----DSRRVDGYVSSTKPLSYA-GTIISG
  176 R-G-----EEFMA-------NMPTEEVFTAP----DSRRVDGYVSSTKPLSYA-GTIISG
  177 R-G-----EEFMA-------NMPTEEVFTAP----DSRRVDGYVSSTKPLSYA-GTIISG
  178 R-G-----EEFMA-------NMPTEEVFTAP----DSRRVDGYVSSTKPLSYA-GTIISG
  179 R-G-----EKFMA-------NMPTEEVFTAP----DSHRVDGYISSTKPLSYA-GTIISG
  180 R-G-----EKFIA-------NMPTEEVFTAP----DSRRIDGFISSTKPLSYA-GSIISG
  181 R-G-----EEFMA-------NMPTEEVFTAP----DANRVDGYISSTKPLSYG-GTILSG
  182 R-G-----ERFMA-------NMPTEEVFTAP----DANRVDGVVSSTKPLSYA-GNTILN
  183 R-G-----ERFMA-------NMPTEEVFTAP----DANRVDGVVRSTKPLSYA-GNTILN
  184 R-G-----ERFMA-------NMPTEEVFTAP----DANRVDGKVVSTKPLSYA-GSVIEG
  185 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  186 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  187 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  188 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  189 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  190 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  191 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  192 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  193 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  194 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  195 Q-G-----EEFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  196 Q-G-----EEFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  197 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  198 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  199 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  200 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  201 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  202 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYN-GNIIEG
  203 Q-G-----ENFLP-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYN-GNIIEG
  204 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYK-GNIIEG
  205 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRAEGHVTSTKPLSYN-GNIIEG
  206 Q-G-----EYFIA-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYN-GNIIEG
  207 Q-G-----EYFIA-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYN-GNIIEG
  208 Q-G-----EYFIA-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYN-GNIIEG
  209 Q-G-----EYFIA-------NMPTEEVFTAP----DFRRAEGYVTSTKPLSYN-GNIIEG
  210 Q-G-----ERFLP-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  211 Q-G-----EYFIA-------NMPTEEVFTAP----DFRRADGYVTSTKPLSYN-GNIIEG
  212 Q-G-----EGFLP-------NMPTEEVFTAP----DFHRADGYVSSTKPLSYN-GNIIEG
  213 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVSSTKPLSYN-GNIIEG
  214 Q-G-----EGFLP-------NMPTEEVFTAP----DFRRADGYVSSTKPLSYN-GNIIEG
  215 Q-G-----ESFLP-------NMPTEEVFTAP----DFRRAYGYVSSTKPLSYN-GNIIEG
  216 Q-G-----ESFLP-------NMPTEEVFTAP----DFRRAYGYVSSTKPLSYN-GNIIEG
  217 Q-G-----EHFIA-------NMPTEEVFTAP----DYRVADGYVTSTKPLSYN-GNIIEG
  218 Q-G-----EHFIA-------NMPTEEVFSAP----DFRVADGYVSSTKPLSYN-GNIIEG
  219 Q-G-----EHFIA-------NMPTEEVFSAP----DYRVAEGYVTSTKPLSYN-GNIIEG
  220 K-G-----EEFIA-------NMPTEEVFTAP----DTHRMEGVVRSTKPLSYA-GTLIEG
  221 Q-G-----EEFIA-------NMPTEEVFTAP----DYRRADGYVSSTKPLSYA-GVVIEG
  222 Q-G-----EEFIA-------NMPTEEVFTAP----DYRRADGYVSSTKPLSYA-GVVIEG
  223 Q-G-----EEFIA-------NMPTEEVFSAP----DYRRADGYVSSTKPLSYA-GVVIED
  224 Q-G-----EEFIA-------NMPTEEVFSAP----DYRRADGYVSSTKPLSYA-GVVIED
  225 Q-G-----EEFIA-------NMPTEEVFTAP----DYRRADGYVSSTKPLSYA-GVVIED
  226 Q-G-----EAFIA-------NMPTEEVFSAP----DYRRADGYVSSTKPLSYA-GVVIED
  227 Q-G-----ETFIA-------NMPTEEVFSAP----DYRRADGYVSSTKPLSYA-GVVIEG
  228 Q-G-----EVFIA-------NMPTEEVFTAP----DYRRADGYVSSTKPLSYA-GVVIED
  229 Q-G-----ETFIA-------NMPTEEVFSAP----DYRRADGYVSSTKPLSYA-GVVIEN
  230 Q-G-----ETFIA-------NMPTEEIFSAP----DYRRADGYVTSTKPLSYA-GVIIEN
  231 K-G-----EVFIA-------NMPTEEVFTAP----DSRRADGYISASKPLAHG-GVVIDG
  232 A-G-----QIFIA-------NMPTEEVFTAP----DSFRAQGYVSASKPLSYG-GVVIDG
  233 K-G-----EIFIA-------NMPTEEVFTAP----DFRRAEGYVSSSKPLAYG-GTVIEG
  234 E-G-----SPFIA-------NMPTEEVFTAP----DTNVMDGYVTSTKPLSYA-GSTIEG
  235 A-G-----IEFMA-------NMPTEEVFTAP----DARHIDGYVGSTKPLSYA-GNIIEN
  236 T-G-----IEFMA-------NMPTEEVFTAP----DARHIDGYVGSTKPLSYA-GNIIEN
  237 E-G-----IEFMA-------NMPTEEVFTAA----DKDRIDGYVTSTKPLSYA-GNILED
  238 E-G-----TEFMA-------NMPTEEVFTAP----DCRRIDGYVTSTKPLSYA-GNILED
  239 D-G-----IPFMP-------NMPTEEVFTAP----DKRRINGHVTSTKPLSYA-GTLIEG
  240 L-G-----IKFMA-------NMPTEEVFTAP----DNRRINGYVTATKPLSYA-GNILEG
  241 R-G-----EEFMA-------NMPTEEVFTAP----DFRRIDGTVASTKPLSYG-GNILED
  242 R-G-----EEFMA-------NMPTEEVFTAP----DFRRIDGTVVSTKPLSYT-GQILEG
  243 R-G-----EEFMA-------NMPTEEVFTAP----DFRRIDGTVASTKPLSYS-GNILEG
  244 R-G-----EEFMA-------NMPTEEVFTAP----DFRRIDGTVTSTKPLSYS-GNILEG
  245 R-G-----EEFMA-------NMPTEEVFTAP----DFRRIDGTVASTKPLSYS-GNILEG
  246 D-G-----RSFVA-------NMPTEEVFSAA----DANNIDGYISSTKPLSYA-GNTLNN
  247 D-G-----RPFVA-------NMPTEEVFSAA----DANHIDGYISSTKPLSYA-GNTLNN
  248 H-G-----QTFMP-------NMPTEEIFTAP----DRYRVDGTVTATKPLSYA-GTIIDG
  249 A-G-----NRFVP-------NMPTEEVFTSP----DYRHIDGTVQSTKPLSYA-GVLITD
  250 A-G-----NRFVP-------NMPTEEVFTAP----DYRHIDGTVQSTKPLSYS-GVLITD
  251 A-G-----NMFVA-------NMPTEEVFTSP----DYRNIHGTVTSTKPLSYA-GVLIND
  252 S-G-----NYFTA-------NLPTEEVFTAP----DYRNINGVVKATKPLSYG-GVLIND
  253 A-G-----NVFIP-------NMPTEEVFTAP----DNRHIDGHVAATMPLSYQ-GNVIEN
  254 A-G-----NVFIP-------NMPTEEVFTAP----DNRHIDGHVAATMPLSYQ-GNVIEN
  255 A-G-----NVFIP-------NMPTEEVFTAP----DNRNIQGHVAATLPLSYQ-GNLIED
  256 A-G-----HIFIP-------NMPTEEVFTAP----DNRHINGHVAATLPLSYQ-GNLIEN
  257 A-G-----HIFIP-------NMPTEEVFTAP----DNRHINGHVAATLPLSYQ-GNLIEN
  258 A-G-----NIFIP-------NMPTEEVFTAP----DNRNIHGHVAATLPLSYQ-GNVIEN
  259 A-G-----NIFIP-------NMPTEEVFTAP----DNRHIDGHVAATMPLSYQ-GNLIDN
  260 A-G-----DIFIP-------NMPTEEVFTAP----DNRYIDGHVAATLPLSYQ-GNIIEN
  261 S-G-----NPFIP-------NMPTEEVFTAP----DNRHIDGTIASTLPLSYS-GNLIRD
  262 Q-G-----NVFVA-------NIPTEEVFTAP----DNRRIDGTLSSTKPLSYS-GKIIEG
  263 A-G-----NTFVA-------NIPTEEVFTAP----DNLHIDGTVTSTKPLSYG-GTIIEG
  264 N-G-----ADFLP-------NMPTEEVFTAG----DRDHADGYVSNKKPLSYQ-GNIIDN
  265 K-G-----ADFLP-------NMPTEEVFTAG----DRDRVDGYVSNKKPLSYQ-GNIIDN
  266 K-G-----DHFMP-------NMPTEEVFTAA----DKYRIDGYVSNKKPLSYQ-GNIIDN
  267 D-G-----IEFMA-------NMPTEEVFTVP----HKDRVNGYVSSTLPLSYG-GNIIDN
  268 D-G-----QPFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLSYN-GNIIDG
  269 D-G-----QPFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLSYN-GNIIDG
  270 D-G-----QPFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLSYN-GNIIDG
  271 D-G-----QPFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLNLN-GNIIDG
  272 D-G-----QPFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLNLN-GNIIDG
  273 D-G-----QPFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLNLN-GNIIDG
  274 N-Q-----QPFIA-------NIPTEEVFTAP----DRNHVDGYVTNKLPLSYN-GNIIDG
  275 N-Q-----QAFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLSFN-GNIIDG
  276 D-Q-----QAFIA-------NIPTEEVFTAP----DRNNVNGYVTNKLPLSFN-GNIIDG
  277 N-Q-----QAFIA-------NLPTEEVFTAP----DRNNVNGYVTNKLPLSYN-GTIIDG
  278 E-E-----QAFIA-------NIPTEEVFTAP----DRNRVDGYVTNKLPLSYN-GTIIDQ
  279 E-E-----QAFIA-------NIPTEEVFTAP----DRNRVDGYVTNKLPLSYN-GTIIDQ
  280 K-E-----QAFIA-------NIPTEEVFTAP----DRNRVDGYVTNKLPLSYN-GTIIDQ
  281 K-E-----QAFIA-------NIPTEEVFTAP----DRNRVDGYVTNKLPLSYN-GTIIDQ
  282 N-E-----QAFIA-------NIPTEEVFTAP----DRNRVDGYVTNKLPLSYN-GTIIDG
  283 N-G-----QAFIA-------NIPTEEVFTAP----DRNRVNGYVTNKLPLSYN-GTIIDN
  284 N-G-----PSFIA-------NIPTEEVFTAP----DRLRVNGYVTNKLPLSHN-GTIIDG
  285 E-G-----QAFVA-------NIPTEEVFTAP----HRLKVNGYVTNKLPLSHN-GNIIDN
  286 E-G-----QAFVA-------NIPTEEVFTAP----HRLNVNGHVTNKLPLSHN-GNIIDG
  287 N-G-----QEFVA-------NIPTEEVFTAP----HRMKVDGHVTNKLPLSYN-GTIIDG
  288 D-G-----QEFIA-------NIPTEEVFTAP----DRNRVNGHVTNKLPLSYN-GSLIDG
  289 Q-G-----QGFIA-------NIPTEEVFTAP----DCNNVNGYVTNKLPLSYN-GTIIDG
  290 K-G-----ETFVP-------NMPTEEVYTMP----NRNFVNGRVYSSKPLANN-GNVIDE
  291 K-G-----EEFVP-------NMPTEEVFTLP----HKDGVNGIVYASKPLIYK-GNLIDE
  292 K-G-----EEFVP-------NMPTEEVFTLP----HKDGVNGIVYASKPLIYK-GNLIDE
  293 Y-G-----NVFVP-------NIPTEEVFTAP----HKDKVNGVVYSTKPLNYG-GNTIDK
  294 Y-G-----NVFVP-------NIPTEEVFTAP----HKDKVNGVVYSTKPLNYG-GNTIDK
  295 Y-G-----NDFVP-------NIPTEEVFTAP----HRDKVNGVVYSTKPLNYG-GNTIDK
  296 K-G-----ISFTA-------NMPTEEVFTLP----HKDGINGVVYSTKALNYN-GNIIDE
  297 K-G-----ISFTA-------NMPTEEVFTLP----HKDGINGVVYSTKALNYN-GNIIDE
  298 K-G-----ISFTA-------NMPTEEVFTLP----HKDGINGVVYSTKALNYN-GNIIDE
  299 K-N-----IPFVP-------NIPTEEVFTLP----HRDRVDGLVYSTKPFNYG-GNIIRD
  300 Y-G-----EEFIA-------NMPTEEVFSMP----HRDGVNGIVYNTKPLNYN-GNLIDD
  301 T-G-----EEFVA-------NIPTEEVFSLP----HREGVDGIVYSTKPLNYN-GNLIDE
  302 D-G-----ETFVA-------NIPTEEVFSLP----HRMGVDGIVYATKPLSYN-GNIIDN
  303 F-G-----EDFVA-------NVPSEEVFSLP----HKYGVNGIVYNTKPLNHS-GVIVDK
  304 F-G-----EDFVA-------NVPSEEVFSLP----HKYGVNGIVYNTKPLNHN-GVIVDK
  305 D-G-----EEFIA-------NMPSEEVFSAP----RLDGVNGKVYSTLPLNYN-GNLIED
  306 K-A-----DRFVA-------NIPTEEVFTMP----HKEQTSGIVYNAKPLNYS-GVLIDN
  307 K-A-----SRFVA-------NIPTEEVFTMP----HKDETSGIVYNAKPLNYS-GVLIDN
  308 K-A-----GRFVA-------NIPTEEVFTMP----HKDVTSGIVYNAKPLNHG-GVLIDD
  309 K-G-----DRFIP-------NMPTEEVFTSP----QYDGVDGRLVASKPLVYN-GVVING
  310 K-N-----DRFIP-------NMPTEEVFTSP----QYDGVDGKLVASKPLVYN-GVVIND
  311 K-G-----DRFIP-------NMPTEEVFTAP----QYDGVDGKLVATKPLVYN-GVVINH
  312 K-G-----DLFLP-------NIPTEEVFTSP----QFDGVDGRLVAVKPLVYN-GVIINN
  313 K-G-----DLFLP-------NIPTEEVFTSP----QFDGVDGRLVAVKPLVYN-GVIINN
  314 K-G-----DLFLP-------NIPTEEVFTSP----QFDGVDGRLVAVKPLVYN-GVIINN
  315 K-G-----FRFVA-------NIPTEEVFTAP----KKTGVNGTVASTMPLNHG-GSLIEG
  316 Q-R-----VAFVA-------NIPTEEVYTVP----LREGVEGTVSSTMPLNHN-GSLIEG
  317 A-G-----VEFNP-------NMPTEEIFTMP----KKTGVNGKVYATKPLDYN-GTLIED
  318 A-G-----VEFNP-------NMPTEEIFTMP----KKTGVNGKVYATKPLDYN-GTLIED
  319 A-G-----VEFNP-------NMPTEEIFTMP----KKTGVNGKVFATKPLDYN-GTLIED
  320 A-G-----VEFNP-------NMPTEEIFTMP----KKTGVNGKVFATKPLDYN-GTLIED
  321 S-G-----IEFNP-------NMPTEEIFTMP----EKTGVYGTVYATKPLDYN-GTLIEN
  322 A-G-----VIFNP-------NMPTEEIFTMP----KKTGVQGKVVASKPLNYN-GNMING
  323 D-G-----VIFNP-------NMPTEEIFTMP----KKTGVQGKVVASKPLNYN-GNMING
  324 Q-G-----ISFNA-------NMPTEEIFSVP----DFHVAEGIVYASKPLLYN-GSLIED
  325 S-G-----VVFNP-------NMPTEENFTMP----KRTGVRGKVQATKPLSYQ-GKLIQN
  326 K-K-----VYFDP-------NIPTEECFTMP----KKTGVNGIVYASKPLSYS-GKVIDG
  327 S-G-----VHFEP-------NIPTEEVFSMP----HKDKVNGIVYASKPLSYS-GKVIEN
  328 R-G-----YTFNP-------NMPTEESFTMP----DRLNVNGIVYSTKPLNYN-GKLIDE
  329 N-G-----VVFNP-------NIPTEESFTMP----YKFGTQGKVVATKPLNNS-GVIIED
  330 S-G-----ITFVP-------NIPTEEIFTAP----HKDKINGVVTNSLPLVYG-GNVIDK
  331 Q-G-----ITFVP-------NIPTEEVFTAP----HREKINGTVSNSLPLVYG-GNIIDK
  332 D-G-----TVFLP-------NIPTEEVFSAP----HKDKINGYVRNSKPLVYG-GNIIDG
  333 N-G-----VPFLP-------NIPTEEVFTAP----SKYGVNGKVSSSMPLVYQ-GNVIDN
  334 D-N-----VPFLP-------NIPTEEVFTAP----YKYGVDGIISSSMPLVYQ-GNIIDE
  335 K-G-----LVFAA-------NIPTEEVFCMP----YKYGVNGVLSSTMPLEYN-GNIIDN
  336 E-G-----IPFNA-------NIPTEEVFTAP----HCRQVDGIVYSTKPLVYQ-GNLIDR
  337 A-G-----IPFNA-------NIPTEEVYSAP----QYDRVDGVVCSTRPLIYR-GNLIDS
  338 R-G-----FLFNA-------NIPTEEVYSAP----QADRVDGVVCSTRPLVYS-GNLIEN
  339 D-H-----LLFNA-------NIPTEEIYSAP----KADAVNGTVYSTKPLVYN-GNLIDK
  340 Y-G-----HFFNA-------NIPTEEVYTAP----RADQVNGTVYNTKPLVYN-GNIIDQ
  341 Y-G-----HFFNA-------NIPTEEVYTAP----RADQVNGTVYNTKPLVYN-GNIIDQ
  342 D-G-----TIFNA-------NIPTEEVFSAP----QYNGVNGIVYSTKPLIYH-GNTISD
  343 D-G-----TIFNA-------NIPTEEVFSAP----QYNGVNGVVHSTKPLIYH-GNTISD
  344 D-G-----TIFNA-------NIPTEEVFSAP----QYNGVNGIVYSTKPLIYH-GNTISD
  345 D-G-----TIFNA-------NIPTEEIFSAP----QYNGVNGIVYSTKPLIYH-GNTISD
  346 D-G-----TIFNA-------NIPTEEIFSAP----QYNGVNGIVYSTKPLIYH-GNTISD
  347 D-G-----TIFNA-------NIPTEEIFSAP----QYNGVNGIVYSTKPLIYH-GNTISD
  348 E-G-----IKFNA-------NIPTEEVFCAP----QWNGVNGKVVSTKPLIYQ-GNPISN
  349 K-G-----IIFDA-------NIPTEEVFSAP----HYTGANGIVYSTKPLIYD-GNRIED
  350 S-G-----VEFTP-------NIPTEEVFSMP----HAYKVNGTLKSTKPLAVR-GQIVDG
  351 R-G-----DVFMA-------NIPTEEVFSMP----HAFKVNGTLKATKPLAAR-GRIIND
  352 A-G-----DPFVA-------NIPTEEVFTTP----YALKVNGTLKATKPLSLN-GKLVDN
  353 K-G-----VPFLP-------NIPTEEVFTAP----HKDKVDGIVYGTKPYVFN-GQLIKN
  354 E-G-----YTFIA-------NIPTEEVFTAP----HRLRVNGVVKGTKPYVYN-GNLIEG
  355 R-G-----IEFIA-------NVPTEEVFCAP----DRNRVDGIVYGTKPYVYN-GQLIEG
  356 G-G-----RLCNP-------NLPTEEVFTAP----HRERVEGVVRASRPLALG-GTLVEG
  357 G-G-----RLCNP-------NLPTEEVFTAP----HRERVEGVVRASRPLALG-GTLVEG
  358 X-G-----XLCNP-------NLPTEEVFTAP----HRERVEGVVRASRPLALG-GTLVEG
  359 K-G-----RLCNP-------NLPTEEVFTAP----HRERVEGVVQASRPLALG-GQLVEG
  360 K-G-----RLCNP-------NLPTEEVFTAP----HRERVEGVVRASRPLALS-GQLVEG
  361 K-G-----RICNP-------NLPTEEVFTAP----HRERVEGVVRSTRPLALG-GQLVEG
  362 D-G-----TACMP-------NMPTEEVFTMP----HRERVNGRVRASKPLVHG-GALIED
  363 D-G-----TACMP-------NMPTEEVFTMP----HRERVNGRVRASKPLVHG-GALIED
  364 N-G-----VVCNP-------NIPTEEVFTTP----HKDRVEGYVSSSKPLAHQ-GSLLDG
  365 N-G-----VVCNP-------NIPTEEVFTAP----HKDRIEGVVRSTKPLSYL-GSLLED
  366 N-G-----ITCNP-------NIPTEEVFTTP----HKDRVEGVVKSTKPLSYQ-GTLIQD
  367 N-G-----IVCNA-------NIPTEEVFTTP----HKDRVDGYVASTKPLSYQ-GTLIED
  368 T-G-----ILCNA-------NIPTEEVFTTP----HRLRVEGRVAATKPLSYQ-GTLIED
  369 S-G-----IICNA-------NIPTEEVFTTP----HRLRVEGRVAATKPLSYQ-GTLIED
  370 N-G-----IVCNA-------NIPTEEVFTTP----HRARVEGYVASTKPLSYQ-GTLIDD
  371 N-G-----IVCNA-------NIPTEEVFTTP----HRARVEGYVASTKPLSYQ-GTLIDD
  372 N-G-----IVCNA-------NIPTEEVFTTP----HRARVEGYVASPKPLSYQ-GTLIDD
  373 N-G-----VVCNA-------NIPTEEVFTTP----HRARVEGYVASTKPLSYQ-GTLIDD
  374 N-G-----IVCNP-------NIPTEEVFTTP----HALRVEGHVRSTKPLSYQ-GTLIDG
  375 N-G-----IICNP-------NIPTEEVFTTP----HALRVEGRVRSTKPLSYQ-GTLIEG
  376 N-G-----IVCNP-------NIPTEEVFTTP----HALRVEGHVRSTKPLSYQ-GTLIDD
  377 N-G-----IVCNA-------NIPTEEVFTTP----HAHRVEGHVSSTKPLSYQ-GTLIDN
  378 N-G-----IVCNA-------NIPTEEVFTTP----HCRRVSGHVRSSKPLSYQ-GTLIDD
  379 N-G-----IVCNA-------NIPTEEVFTTP----HCRRVSGHVRSSKPLSYQ-GTLIDN
  380 N-G-----IVCNA-------NIPTEEVFTTP----HCRRVSGHVRSSKPLSYQ-GTLIDD
  381 N-G-----IVCNA-------NIPTEEVFTTP----HCRRVSGHVVSSKPLSYQ-GTLIDN
  382 N-G-----ITCNA-------NIPTEEVFTTP----HCRRVSGYVKSSKPLSYQ-GTLIDN
  383 N-G-----ITCNA-------NIPTEEVFTTP----HCRRVSGYVVSSKPLSYQ-GTLIDN
  384 N-G-----ISCNA-------NIPTEEVFTTP----HCRRVYGHVVSSKPLSYQ-GTLIDN
  385 N-G-----ISCNA-------NIPTEEVFTTP----HCRRVYGHVVSSKPLSYQ-GTLIDN
  386 N-G-----ISCNA-------NIPTEEVFTTP----HCRRVYGHVVSSKPLSYQ-GTLIDN
  387 N-G-----ISCNA-------NIPTEEVFTTP----HCRRVYGHVVSSKPLSYQ-GTLIDN
  388 N-G-----ITCNP-------NIPTEEVFTTP----HARRVEGHVSSTKPLSYQ-GTLIDD
  389 N-G-----ITCNP-------NIPTEEVFTTP----HARRVEGHVSSTKPLSYQ-GTLIDD
  390 N-G-----ITCNP-------NIPTEEVFTTP----HARRVEGHVSSTKPLSYQ-GTLIDD
  391 N-G-----ITCNP-------NIPTEEVFTTP----HARRVEGHVSSTKPLSYQ-GTLIDE
  392 N-G-----VTCNP-------NIPTEEVFTTP----HARRVSGHVSSTKPLSYQ-GTLIDE
  393 N-G-----VTCNA-------NIPTEEVFTTP----HAHRVEGRVVSSKPLSYQ-GSLIED
  394 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  395 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  396 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  397 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  398 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  399 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  400 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTLIDN
  401 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVSSTKPLSHQ-GTVIDN
  402 N-G-----ITCNP-------NIPTEEVFTTP----HALKVDGVVSSTKPLSHQ-GTLIDN
  403 N-G-----VTCNP-------NIPTEEVFTTP----HALKVEGHVSSTKPLSHQ-GTLIDN
  404 N-G-----VTCNP-------NIPTEEVFTTP----HALRVDGYVSSTKPLSHQ-GTLIDD
  405 N-G-----VTCNP-------NIPTEEVFTTP----HALRVDGYVSSTKPLSHQ-GTLIDD
  406 N-G-----VTCNP-------NIPTEEVFTTP----HALRVDGYVSSTKPLSHQ-GTLIDD
  407 N-G-----VTCNP-------NIPTEEVFTTP----HALRVDGYVSSTKPLSHQ-GTLIDD
  408 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGHVTSTKPLSHQ-GTLIEN
  409 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGYVTSTKPLSHQ-GTLIED
  410 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  411 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  412 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  413 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  414 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  415 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  416 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  417 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  418 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  419 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  420 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  421 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  422 N-G-----ITCNP-------NIPTKEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  423 N-G-----ITCNP-------NIPTKEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  424 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  425 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  426 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  427 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  428 N-G-----ITCNP-------NIPTEEVFTTP----HALRVDGHVTSTKPLSHQ-GTLIEN
  429 N-G-----ITCNP-------NIPTEEVFTTP----HALRVEGYVSATKPLSHN-GTLIRD
  430 N-G-----ITCNP-------NIPTEEVFTTP----HARRVNGVVRSTKPLSHN-GSVIED
  431 N-G-----VICNP-------NIPTEEVFTTP----HAYRVDGFVRSTKPLSYQ-GTLIDN
  432 N-G-----VICNP-------NIPTEEVFTTP----HAYRVDGFVRSTKPLSYQ-GTLIDN
  433 N-G-----VVCNP-------NIPTEEVFTTP----HAYKVDGFVRSTKPLSYQ-GMLIDN
  434 N-G-----VVCNP-------NIPTEEVFTTP----HAYKVDGFVRSTKPLSYQ-GTLIDN
  435 N-G-----VVCNP-------NIPTEEVFTTP----HAYKVEGFVRSTKPLSYQ-GALIDN
  436 N-G-----VICNP-------NIPTEEVFTTP----HAHKVEGFVRSTKPLSYQ-GTLVDN
  437 N-G-----VVCNP-------NIPTEEVFTTP----HAHKVEGFVRSTKPLSYQ-GTLIDN
  438 N-G-----VVCNP-------NIPTEEVFTTP----HAHKVEGFVRSTKPLSYQ-GALIDN
  439 N-G-----VVCNP-------NIPTEEVFTTP----HAHKVEGFVRSTKPLSYQ-GTLIKN
  440 N-G-----VVCNP-------NIPTEEVFTTP----HAHRVDGTVRSTKPLSHQ-GSLIDG
  441 N-G-----VVCNP-------NIPTEEVFTTP----HAHRVDGTVRSTKPLSHQ-GSLIDG
  442 N-G-----VTCNP-------NIPTEEVFTTP----HARRVNGTVRSTKPLSHQ-GSLIDG
  443 N-G-----VNCNP-------NIPTEEVFTTP----HAARTEGHVRASKPLSHQ-GSLIEN
  444 N-G-----ISSNP-------NIPTEEVFTTP----HAAMTEGTVSATKPLAHG-GTLIRD
  445 N-G-----ITGNP-------NIPTEEVFTTP----HAGMTEGTVSATKPLAHQ-GTLIRD
  446 N-G-----VTCQP-------NIPTEEVFTCP----HAYKVDGTVAATKPLAHQ-GRVIED
  447 N-G-----VVCQP-------NIPTEEVFTCP----HAYKVDGVVSATKPLAHQ-GNVIEN
  448 N-G-----IICNP-------NIPTEEVFTTP----HARKVSGTVRATKPLFHQ-GTLIDD
  449 N-G-----ITCNP-------NIPTEEVFTTP----HARKVSGTVRATKPLFHQ-GTLIDD
  450 N-G-----IVCNP-------NIPTEEVFTTP----HARKVSGTVRATKPLFHQ-GTLIDD
  451 N-G-----IVCNP-------NIPTEEVFTTP----HARKVSGTVRATKPLFHQ-GTLIDD
  452 N-G-----ITCNP-------NIPTEEVFTTP----HARRVDGTVRATKPLFHQ-GTLIDD
  453 N-G-----IVCNP-------NIPTEEVFTTP----HARRVEGYVRATKPLFHQ-GTLIDG
  454 N-G-----IVCNP-------NIPTEEIFTTP----HRSKVDGRVSSTKPLFHQ-GTLIDN
  455 N-G-----IVCNP-------NIPTEEIFTTP----HRARVDGHVCSTKPLFHQ-GTLIDE
  456 N-G-----IVCNP-------NIPTEEVFTTP----HRLKVDGTVAATKPLSHQ-GTLIED
  457 N-G-----IVCNP-------NIPTEEVFTTP----HRLKVDCTVAATKPLSHQ-GTLIED
  458 N-G-----IVCNP-------NIPTEEVFTTP----HRLKVDGTVAATKPLSHQ-GTLIED
  459 N-G-----VICNP-------NIPTEEVFTTP----HRLKVDGYVASTKPLSYQ-GTLIDQ
  460 N-G-----VTCNP-------NIPSEEVFTTP----YASKVNGYVKSTKPLSHQ-GTLIED
  461 N-G-----QYCIP-------NLPTEEVFTTP----HKDRVNGTVTSTKPLSHQ-GTLIEK
  462 N-G-----LYCIP-------NIPTEEIFTTP----HKDRADGTVTASKPLSHM-GTLIED
  463 N-G-----VFCNA-------NIPTEECFTTP----HKDRIDGVVHASKPLSHQ-GTLIEN
  464 N-G-----IFSNA-------NIPTEECFTTP----HKDRVNGTVSASKPLSHQ-GTLIEN
  465 N-G-----VYCQP-------NIPTEECFTTP----HKDRVNGVVTASKPLSHQ-GTLIEN
  466 N-G-----IICNP-------NIPTEEVFTTP----HAQKVEGYVSSTKPLVYQ-GMLIDD
  467 N-G-----IMCNP-------NIPTEEVFTAP----HARRVEGYATSTKPLVYQ-GMLIEN
  468 N-G-----IMCNP-------NIPTEEVFTAP----HARRVEGYATSTKPLVYQ-GMLIEN
  469 N-G-----ARCVP-------NLPTEEVFTTP----HRERVEGWVQSTKPLSLH-GHLLEG
  470 S-G-----ITFTA-------NIPTEEVWTAP----HRERVDGVVVSTKPLSYN-GVLIDG
  471 G-G-----ITFTA-------NIPTEEVWTAP----HRERVDGVVVSTKPLSYN-GVLIDG
  472 S-G-----ITFTA-------NIPTEEVWTAP----HRERVDGVVVSTKPLSYN-GVLIEG
  473 S-G-----VTFTA-------NIPTEEVWTAP----HRERVDGVVVSTKPLSYA-GTLIDG
  474 S-G-----IEFTA-------NIPTEEVWTAP----HRERVDGVVVSTKPLSYQ-GVLIDG
  475 E-G-----GRFVP-------NIPTEEVWTAP----HREKVDGVVVSTKPLSYN-GVLIDG
  476 A-G-----TRFVA-------NLPTEEVFTAP----HRARVDGVVASSKPLSYA-GQLIED
  477 N-G-----IRAVP-------NLPTDEVFTAP----HRERVDGWAAASKPLSAR-GQLIEG
  478 N-G-----IRGVP-------NLPTDEVFTAP----HRDRVDGWAVASKPLSVR-GQLVEG
  479 N-G-----IRAVP-------NLPTDEVFTAP----HRDRVDGVAVASKPLSVR-GQLVEG
  480 N-G-----IVGVP-------NLPTDEVFTMP----HRDRVNGVAVASKPLSVR-GQVVEG
  481 T-G-----TRTVP-------NMPTDEVFTAP----HRDRVDGVAVASKPLSVH-GTLVSG
  482 N-G-----VVGVP-------NLPTDEVFTAP----HRDRVDGVATATKPLIAR-GTTISG
  483 N-G-----VRFVP-------NLPTEEVFTAP----DPERVEGVVTCTRPLNIG-GTLVEG
  484 N-G-----ALPVC-------NFPTEEVFTCP----HRDQVEGRLAASRPIALG-GIVIDG
  485 M-G-----SSFIC-------NMPTEEIYTTP----LKKGVNGIVKNTKPLVYE-GQIIDQ
  486 A-G-----IWFQP-------NMPSEEVFSMP----HNRRTQGYVRTSRPSFPM-QREVND
  487 N-G-----NYYFP-------NIPTEEIFSAP----KKTGVNGKLYSALPLAYN-GAVVKD
  488 G-G-----IAHQA-------NVPTEEVFTTP----DPARVDGVVRATKPLTLG-GTTVDG
  489 D-G-----IAHLP-------NLPSEEVYATP----DPARVEGVVRATKPLMLD-GTAVEG
  490 GTD-----IEFNA-------NMPTQEVFTTP----NYKKTNGIMHVTRPITVL-GNLITG
  491 GTN-----IEFNA-------NMPTEEVYTTP----NYKKTNGIMYVTRPVTVL-GNLITG
  492 GTE-----IEFNA-------NMPTQEVFTTP----NYKKTNGIMYATRPVKIL-GNLITG
  493 GTE-----IEFNA-------NMPTQEVFTTP----NYKKTNGIMYATRPVRIL-GNLITG
  494 GTE-----IEFNA-------NMPTQEVFTTP----NYKKTNGIMYATRPVRIL-GNLITG
  495 ETE-----IEFNA-------NIPTEEVFTTP----NYKKTQGIVYATRPVMVL-GTLISG
  496 GTE-----IEFNA-------NMPTEEVFTTP----NYKKTKGIVYATRPVMVL-GTLISG
  497 GTE-----IEFNA-------NMPTEEVFTTP----NYKKTKGIVYATRPVMVL-GTLISG
  498 GTE-----IEFNA-------NMPTEEVFTTP----NYKKTKGIVYATRPVMVL-ETLIYG
  499 GTE-----IEFNA-------NMPTEEVFTTP----NYKKTKGIVYATRPVMVL-ETLIYG
  500 GTE-----IEFNA-------NMPTEEVFTTP----NYKKTKGIVYATRPVMVL-ETLISG
  501 GTE-----IEFNA-------NMPTEEVFTTP----NYKKTKGIVYATRPVMVL-GTLISG
  502 N-G-----RSFLP-------NIPTEEVFTTP----DFRTAEGTVVATRPVKVM-ETLVHQ
  503 D-S-----RVFFP-------NIPSEELFTTP----HMLRADGYITTTRPVSVL-NARTEE
  504 D-G-----LQFFA-------NLPTEEIFTTP----DRMRAQGYVTTTKPVTVL-DVKTEE
  505 D-G-----RPFFP-------NIPTEEIFTVP----DMTRAEGYVTSTRPVTVM-DTPTEE
  506 K-N-----IRYMP-------NFPTQEIFTAP----KKTGVTGVMCNTKPLCHT-GRVADD
  507 K-G-----IRYMP-------NFPTQEIFTAP----KKTGITGIMHNTKPLNYS-GRLINE
  508 D-G-----HY----------NMPGGEVFSAP----VEDSVEGYVEFEYPAIWR-GVEVEG
  509 D-G-----HY----------NMPGGEVFSAP----VEDSVEGYVEFEYPAIWR-GVEVEG
  510 D-G-----HY----------NMPGGEVFSAP----LEDSVEGYVEFDYPAVWR-GVEVEG
  511 D-G-----KY----------NMPGGEVFSAP----IEDSVEGYVEFDYPAIWR-GVEVEG
  512 D-G-----KY----------NMPGGEVFSAP----IEDSVEGYVEFDYPAIWR-GVEVEG
  513 D-G-----KN----------NMPGGEVFTGP----VEESVEGTVEFDYPAIWR-GVEVEE
  514 D-G-----RY----------NMPGGEVFTGP----VEDTAEGYIEFDYPAIWR-GVEVEG
  515 D-G-----KN----------NMPGGEVFSAP----IEDSIEGYITFTYPAIWK-GVEVEN
  516 D-G-----KN----------NMPGGEVFTAP----HEDSVEGYITFNYPAVYS-GYEIEG
  517 D-G-----KK----------NMPGGEVFTAP----HEDGVEGVVTFDFPAVWR-GLEVEG
  518 D-G-----KT----------NMPSGEVYTAP----VEDSVEGQIHFAYPSIFQ-GQEVEG
  519 K-G-----EE----------NYPGGEVFTGP----IENSVEGKIRFSFPGIYS-GQEIKD
  520 K-G-----EE----------NYPGGEVFTGP----VEDSVEGKIRFSFPGIFQ-GKEIED
  521 N-G-----SH----------NMPDGEVFTSP----VEDSANGEMFFDVPTSFM-GVSAKN
  522 N-G-----NH----------NMPDGEVFTSP----VEDSADGVIFFDVPTAFM-GVEVQD
  523 N-G-----HH----------NMPDGEVFTSP----VEDGVNGQIYFDLPTSYM-GVEAGG
  524 N-G-----HH----------NMPDGEVFTSP----VEDGVNGTIYFDVPTSYM-GVEAGG
  525 D-G-----KL----------NMPDGEIFTGP----VEDSAEGYVYFSYPAIEA-GREVTG
  526 D-G-----KL----------NMPDGEVFTGP----VEDSAEGHVYFSYPAIEA-GREVTG
  527 D-G-----KL----------NMPDGEVFTGP----VEGSAEGHVYFSYPAIES-GREVTG
  528 D-G-----KL----------NMPDGEVFTGP----VEDSAEGHVYFSYPAIES-GREVTG
  529 D-G-----KL----------NMPDGEVFTGP----VEDSAEGHVYFSYPAIES-GREVTG
  530 D-G-----RF----------NMPDGEIFTGP----VENSANGHVYFSYPAIEA-GREVTG
  531 C-G-----IH----------NMPDGEIYTGP----VEDSVEGWVRFTYPAIYG-GRAVEG
  532 I-G-----VY----------NMPDGEIYTGP----VEDSVNGWVRFTYPAIYN-GVAVEG
  533 D-G-----KR----------NFPSGEFFTSP----VENSANGVIQYDIPSTYA-GRPVNG
  534 A-G-----DA----------NFPDGEFFTGP----EETNVNGVVRFSFPAIYN-GREVED
  535 D-G-----HI----------NFPDGEVFTGP----VEDSVRGTIRFSFPGIFQ-GQEIED
  536 D-G-----HI----------NFPDCEVFTGP----VEESVRGTIRFSFPGIFQ-GKEIED
  537 A-G-----DR----------NFPDGEVFSSC----DETATEGYIRYTFPAIYA-GREVED
  538 A-G-----DR----------NFPDGEVFSSC----DETATQGYIRYSFPAIYA-GREVED
  539 D-G-----RK----------NFPDGEIFTGP----VEDSVEGTIRFSYPSMVQ-GRQVED
  540 D-G-----RR----------NFPDGEIFTGP----IEDSVEGTIRFSYPSMVQ-GRRVED
  541 D-G-----HR----------NFPSGEIFVGP----VEDSVEGHIRFTHATIVQ-GREVED
  542 D-G-----KH----------NFPDGEVFTGP----IEDSVNGHIRFSYPAVYN-GREVEN
  543 D-G-----KR----------NMPSGEVFTGP----WETSAGGEVTFNLPAVVA-GQRVEG
  544 D-G-----KR----------NMPSGEVFTAP----HEDAVEGEIRFNLPAVVS-GQRVEG
  545 D-G-----RR----------NMPSGEVFTGP----VEDSAEGEVRFNLPAFVG-GRRVEG
  546 D-G-----RR----------NMPSGEVFTGP----LEDSAEGEVRFNLPAFVG-GRRVEG
  547 D-G-----RR----------NMPSGEVFTGP----LEDSAEGEVRFNLPAFVG-GRRVEG
  548 D-G-----KR----------NMPSGEVFTSP----LEASVEGPVRFNLPVVVA-GQRVEG
  549 D-G-----KR----------NMPSGEVFTGP----HETSANGTIRFTVPSSPG-GVDVED
  550 D-G-----RS----------NFPSGEVYTAP----LEDSVEGEVRFDLPILAG-GRWVRG
  551 D-G-----KR----------NMPSGEVFTGP----LEDSAEGVVTFTIPASYG-GVVVRG
  552 D-G-----RR----------NMPSGEVFTGP----LEDSAEGVVTFTIPAAYQ-GQMVRG
  553 D-G-----KR----------NMPSGEVFTGP----LEDSAEGVVTFTVPASYQ-GQTVRG
  554 D-G-----RR----------NMPSGEVFTGP----VEDSANGYVTFSVPTIYG-GQWVRG
  555 D-G-----KR----------NMPSGEVFTGP----LEDSAQGVITFDLPTVFQ-GARVRG
  556 D-G-----RR----------NMPSGEVFTGP----LESSAEGTVTFNVPSTLR-GVEVRG
  557 A-G-----TH----------NMPCGEVFTGP----VEDSANGRIYFGVPVAVA-GREVSG
  558 D-G-----RR----------NMPSGEIFTGP----IEESIQGRLRSTFPVCRD-GRRLEG
  559 D-G-----RR----------NMPSGEIFTGP----IETSATGRLRCGFPVCRG-GRELVG
  560 A-G-----KR----------NLPDGEVFTAP----IEDSVNGRLKISYPSIYQ-GNLVSG
  561 C-G-----KI----------NFPDGEVYTGPNLKASDGGVNGIARYSFPTLYR-NTEVHE
  562 Y-G-----EK----------NLPGGEVFTAP----VSDSVEGEVLFDKPLYHQ-GREVTD
  563 Y-G-----EK----------NLPGGEVFTAP----VPDSVEGEVLFDKPLYHQ-GREVTD
  564 Y-G-----ER----------NLPGGEVFTAP----VADSVEGEVLFDKPLYHQ-GREVTD
  565 H-G-----EH----------NLPGGEVFTAP----VPDSVEGEVLFDMPLYHQ-GREITD
  566 H-G-----EH----------NLPGGEVFTAP----QPDSVEGEVLFDMPLYHQ-GREITD
  567 H-G-----EH----------NLPGGEVFTAP----QPDSVEGEVLFDMPLYHQ-GREITD
  568 Y-G-----EK----------NLPGGEVFTAP----VPDSVEGSVFFDKPLYHQ-GREITD
  569 Y-A-----EK----------NLPGGEVFTAP----VVDSVEGEVLFDMPLYHQ-GREITG
  570 T-D-----SH----------NLPGGEVFTAP----LPDSVEGEVLFDKPVYRR-GREITD
  571 T-D-----TH----------NLPGGEVFTAP----IPDSVEGDVLFDKPVYRR-GREITD
  572 E-G-----KN----------NLPGGEVFTAP----VPDSVEGEVLFDKPLVHQ-GNIVEN
  573 K-G-----EK----------NLPGGEVFTAP----VKDSVNGEVHFDMPLYRQ-GREISG
  574 Y-G-----EK----------NLPGGEVFTAP----IKHSVEGEVHFDMPLYRQ-GREIED
  575 T-A-----EH----------NLPGGEVFTAP----VRDSVNGEVHFDLPLYRQ-GREVSG
  576 Y-G-----EA----------NLPGGEVFTAP----VRDGVDGEVHFDLPLYRY-GREIEG
  577 Y-G-----EA----------NLPGGEVFTAP----VKDSVEGTVHFDLPLYRQ-GREVQD
  578 C-G-----SN----------NLPAGEVFTAP----VPDSVEGEVVFDKPVYHQ-AREIQG
  579 C-G-----TN----------NIPAGEVFTAP----VPDSVEGEVLFDKPVYHQ-AREVQG
  580 A-G-----RH----------NMPSGEVFTAP----VPDSVEGTVHFDKPLIHQ-GREMEG
  581 Y-D-----SH----------NLPSGEVFTAP----ADA--EGEVTFDVPMTVR-GKTLRD
  582 Y-D-----SH----------NLPSGEVFTAP----ADA--EGEVTFDVPMTVR-GNTLRD
  583 Y-D-----SH----------NLPSGEVFTAP----TAT--EGTVTFDVPMTVD-GTRVRD
  584 Y-D-----SH----------NLPSGEVFTAP----HDT--AGVVTFDVPMTIQ-GRRVKN
  585 Y-D-----SH----------NLPSGEVFTAP----YDT--AGVVTFDVPMTIQ-GRRVKN
  586 Y-D-----SH----------NLPSGEVFTAP----TAT--EGEVHFDVPMTLR-GERVQG
  587 Y-D-----SH----------NLPSGEVFTAP----AAT--EGEVFFDVPMTIR-GERVQD
  588 Y-D-----SH----------NLPSGEVFTAP----YAT--EGEVTFDVPMTLR-GESVRD
  589 Y-D-----SH----------NLPSGEVFTAP----YAT--EGEVTFDVPMTIR-GEAVRD
  590 Y-D-----SH----------NLPSGEVFTAP----YAT--EGEVTFDVPMTLR-GEAVRN
  591 Y-D-----SH----------NLPSGEVFTAP----AAT--EGEVTFDVPMTLR-GEAVRN
  592 Y-D-----SH----------NLPSGEVFTAP----YGT--EGEVTFDVPMTLR-GESVRG
  593 Y-D-----SH----------NLPSGEVFTAP----YDP--EGEVFFDVPMTIS-GSRVRN
  594 Y-D-----SH----------NLPSGEVFTAP----VEDAVEGEVFFDVPMTLE-GQRVEN
  595 Y-D-----SH----------NLPSGEVFTAP----YAT--EGEVFFDVPMTLQ-GNRIQN
  596 Y-D-----SH----------NLPSGEVFTAP----VETTVSGTVQFDVPMVIR-DTRIRD
  597 D-G-----RI----------NMPGGEISTAP----VEHTVEGTIYFDSPAVFG-GKVVQD
  598 M-G-----HK----------NMPDGEIATAP----IENTVDGHIYFEFPGVLS-GKLVEN
  599 A-G-----NA----------NWPDGEIATAP----VETAVNGRIRFDGTLSFG-GVLIRD
  600 P-G-----QY----------NIPDGEVFTAP----IRDSVNGVLSFNTPSPYQ-GFTFEK
  601 A-G-----EN----------NIPDGEVFTAP----VRDSVNGVLTYNTATVYQ-GTKFDH
  602 S-G-----QR----------NIPDGEVFSAP----VRDSVNGVITYNSPSVYS-GTTFQN
  603 S-G-----QK----------NIPDGEVYTAP----VRDSVNGTIAYNTPTLYN-GVTFEN
  604 C-G-----KR----------NIPDGEVYSAP----VRDSVNGTIAYNTPSVSG-GVTFEN
  605 C-G-----KR----------NIPDGEVYTAP----VIDSVNGVISYNTPTVYS-GSSFEN
  606 D-G-----KR----------NIPDGEVYTAP----VRDSVEGTIFYNAASIYN-GITFND
  607 A-G-----KR----------NIPDGEVFSAP----VKDSVNGYITYNTPAQYQ-GFTYEN
  608 A-G-----KR----------NIPDGEVYTAP----ERESVNGFITYNTPAVYQ-GFTYEN
  609 D-G-----RR----------NVPDGEVYTAP----VKDSVNGVVTYNTPSSYQ-GFTFEN
  610 D-G-----KM----------NIPDGEVFTAP----IRDSVNGVISYNCPAVYQ-GVTFEN
  611 C-G-----LR----------NIPDGEVYTAP----VRNSVNGVLSYNTPAVYQ-GVTYEN
  612 D-G-----KK----------NIPDGEIYTAP----VRNSVNGYITYNTPALYQ-GYTFEN
  613 D-G-----KM----------NLPDGEIFTAP----VIDSVNGKLTYNTPAVYQ-GYTFEN
  614 D-G-----HL----------NIPDGEIFSAP----LKESVNGQISYNTPSLYQ-GFAYNN
  615 D-G-----HM----------NIPDGEVYTAP----LRESVNGRISYNTAALYQ-GFTYEN
  616 A-G-----KR----------NIPDGEVYTAP----VRDSVNGHITYNTPALYQ-GFTYEN
  617 A-G-----EA----------NIPDGEVFTAP----VRDSVNGTIAYNTPSPYQ-GFTYDN
  618 A-G-----LR----------NIPDGEVYTAP----VKNSVNGVITHNAPTPYH-GFTFEN
  619 A-G-----EM----------NIPDGEVYTAP----VRDSVNGTISYNTPTPYQ-GFTFEQ
  620 A-G-----HM----------NIPDGEVYTAP----IRDSVNGTLSYNTPSPYQ-GFTFES
  621 S-G-----QM----------NIPDGEVYTAP----VKDSVNGVITYNTPSPYH-GFTFEH
  622 S-G-----QM----------NIPDGEVYTAP----VRDSVNGTITFNTPSPYQ-GFTFEN
  623 A-G-----EM----------NIPDGEVYTAP----VRDSVNGTISYNTPSNYQ-GFTFEN
  624 A-G-----RL----------NIPDGEVYTAP----VKDSVNGTITYNTPSPYH-GFTFEN
  625 S-G-----HL----------NIPDGEVYSAP----VRDSVNGTVSYNTPSPYN-GYTFEN
  626 S-G-----HL----------NIPDGEVYSAP----VRDSVNGTVSYNTPSPYN-GFTFEN
  627 S-G-----HL----------NIPDGEVYSAP----VRDSVNGTVSYNTPSPYN-GYTFEN
  628 S-G-----HL----------NIPDGEVYSAP----VRDSVNGTVSYNTPSPYN-GYTFEN
  629 S-G-----HL----------NIPDGEVYSAP----VRNSVNGTISYNTPSPYN-GYTFEN
  630 A-G-----EM----------NIPDGEVFTAP----VRDSINGKLTYNTPSPYQ-GFTFEN
  631 A-G-----EM----------NIPDGEVFTAP----VRDSINGKLTYNTPSPYQ-GFTFEN
  632 A-G-----EM----------NIPDGEVFTAP----VRDSINGTLTYNTPSPYQ-GFTFEN
  633 A-G-----EM----------NIPDGEVFTAP----VRDSINGTLTYNTPSPYQ-GFTFEN
  634 A-G-----EM----------NIPDGEVFTAP----VRDSINGTLTYNTPSPYQ-GFTFEN
  635 A-G-----NA----------NIPDGEVFTAP----VKDSINGTIAYNTPSPYQ-GFTFEN
  636 S-G-----QM----------NIPDGEVFTAP----VKDSVNGVITYNTPSPYQ-GFTFEN
  637 A-G-----KL----------NIPDGEVYTAP----VRDSVNGTIAYNTASPYQ-GTTFEN
  638 A-G-----RL----------NIPDGEVYTAP----VKNSVNGTITYNTASPYQ-GFTFEN
  639 S-G-----EC----------NIPDGEVFTAP----VRDSINGTLSYNTPSAFQ-GFTYEN
  640 D-G-----HM----------NIPDGEVYTAP----VKNSVNGYITYNTPSNYA-GFKFEN
  641 D-G-----HM----------NIPDGEVYTAP----VKDSVNGYITYNTPSNYA-GFKFEN
  642 D-G-----HM----------NIPDGEVYTAP----VKNSVNGYITYNTPSNYA-GFKFEN
  643 D-G-----HM----------NIPDGEVYTAP----VKNSVNGYITYNTPSNYA-GFKFEN
  644 D-G-----HM----------NIPDGEVYTAP----VKDSVNGHITYNTPSNYA-GFKFEN
  645 D-G-----HM----------NIPDGEVYTAP----VKDSVNGYITYNTPSNYA-GFKFEN
  646 D-G-----HM----------NIPDGEVYTAP----VKDSVNGYITYNTPSNYA-GFKFEN
  647 D-G-----HR----------NIPDGEVYTAP----VKESVNGVITYNTPSVYQ-GYTFEN
  648 A-G-----EL----------NIPDGEVYTAP----VKNSVNGVLSYNTPSLYSDGFTYEN
  649 A-G-----EL----------NIPDGEVFTAP----VKNSVNGVLTYNTPSLYSDGFTYEN
  650 D-G-----ER----------NIPDGEVYTAP----VRNSVNGVISYNTPSLES-GFVYEN
  651 C-G-----NM----------NIPDGEIYTAP----IKDSVNGTISYNTKSDHL-GFIYEN
  652 C-G-----NM----------NIPDGEVYTAP----VQGSIEGVIHYNTPTLYE-GKQFSN
  653 G-G-----RH----------NIPDGEVFSCP----VKDSVEGEITFNAPTVYQ-GTSFDN
  654 G-G-----LR----------NIPDGEVFSCP----VRESVDGVLQYNAPSVYL-GTSFDN
  655 V-G-----TF----------NIPDGEVFSCP----VIDSVEGVLQYNAPTVYQ-GVSFDD
  656 G-G-----TH----------NIPDGEVFTAP----VRNSVQGYVTYNAPSIYQ-GTAFDN
  657 K-G-----DR----------NIPDGEVFSCP----VKNSVNGYITFNTPTLYS-GTKFEN
  658 N-G-----RR----------NIPDGEVFTAP----VRDSVNGTISYNIPSRYQ-GTVFRN
  659 V-G-----KR----------NIPDGEVYTSP----VRDSIHGTISYNTPSNFK-GTTFEN
  660 S-G-----LR----------NIPDGEIFTAP----VRDSVNGTITYNTATSYM-GTKFEN
  661 D-G-----SA----------NIPDGEVYTCP----VRESVEGMISYNTPSTLD-GFTYRD
  662 A-G-----EM----------NIPDGEIYTAP----VRTSVNGTIAYNCDSTYR-GHKFSD
  663 A-G-----EC----------NLPDGEVFTAP----VIDSANGHISFNTPSLFQ-GIPFDN
  664 A-G-----EK----------NIPDGEVFTAP----HVESVEGVIQFNTPTVYQ-GAFFEG
  665 D-G-----KL----------NLPDGEVFTAP----VKNSVNGRITFNTKSIYG-GQTFNN
  666 D-G-----RF----------NMPDGEVFTAP----VRESVEGHITYNCPSIYQ-GKEFNA
  667 D-G-----RY----------NIPDGEVFTAP----VRDSVQGVITYNCPTIYQ-GKEFNN
  668 D-G-----RF----------NIPDGEVFTAP----VKDSVEGYITYNCPTVYQ-GKEFNN
  669 D-G-----RY----------NIPDGEVYTAP----IKTSVEGYITYNCPTVYQ-GKEFND
  670 D-G-----RF----------NIPDGEVFTAP----VRDSVEGHITYNCPTIYQ-GKEFNG
  671 D-G-----RL----------NIPDGEVFTAP----VRDSVQGYITYNCPTVYQ-GKEFNN
  672 D-G-----RL----------NIPDGEVFTAP----VRDSVQGYITYNCPTVYQ-GKEFNN
  673 D-G-----SHFTFCNSLIAKNVPGSEIFSAP----RKNSVNGVVVAKGKFTHG-GALIED
  674 S-G------H----------NIPSFELFLSP----DWRGTQGIYYADQPSYRS-GNLVQG
  675 S-G------H----------NIPSFELFLSP----DYRKTQGVFFSDQPSYRS-GNLVRG
  676 S-G------H----------NIPSFEIFTSP----DWRGTSGRYYADQPSYRS-GNYVRG
  677 S-G------H----------NIPSFEIFTSP----DWRGTSGRYYADQPSYRS-GNYVRG
  678 S-G------H----------NIPSFEIFTSP----DWRGTSGRYYADQPSYRS-GNYVTG
  679 S-G------H----------NIPSFEIFTSP----DWRGVSGRYFADQPSYRS-GNLVSG
  680 S-G------H----------NIPSFEIFLSP----DWRGTEGVYYADQPSYRS-GNYVEG
  681 S-G------H----------NIPSFEIFLSP----DWRGTEGVYYADQPSFRS-GNFVEG
  682 S-G------H----------NIPSFELFISP----DWRGTSGVYYADQPSYRS-GNYVEG
  683 S-G------H----------NIPSFELFISP----DYRLTEGTYHADQPSYRS-GNLVSG
  684 T-G------H----------NIPSFEMYISP----DWRGTEGVFYADLPSYRS-GNYIKG
  685 S-G------H----------NIPSFELFLSP----DWRNTKGVYFANQPSYRS-GNYVEN
  686 S-G------H----------NIPSFEIFLSP----DWRGSRGVYFADMPSFRN-GNPVRD
  687 S-G------H----------NIPSFELFLSP----DWRGTEGVYFANQPSFRS-GNYVKD
  688 S-G------H----------NIPSFEIFLSP----DWRGTEGTYYANQPSFRM-GNYVEG
  689 T-G------R----------NIPSFELYVSP----DWRSVEGVYTADLPSFRS-GNIVQG
  690 T-G------R----------NIPSFELYVSP----DWRSVEGVYTADLPSFRS-GNIVRG
  691 T-G------R----------NIPSFELYVSP----DWRTVEGSYVADLPSFRS-GNITSG
  692 T-G------R----------NIPSFEMYVSP----DCRGTEGVYYADLPSYRS-GNIVKG
  693 S-G------R----------NIPSFELFVSP----DWHGTQGRIQFTEPLYRY-GSLIEN
  694 ECG-----------------NLPGAEAYIAP----LEGTANGRVVIDGSMAGI-GVLKEP
  695 W-G-----------------NLPGGETFTTPEQVDGIFVIDGVVGDYLCEKYG-DLRANP

      8        29           30         31        32        33     
      0123456789012AB345A6789012345678A901234567890123456789012345
                                              #                   
                                                                  
    1 FSLTFHEGKVVDF--DAR-EGYDALKQLLDTD-EGSKSLGEVALVPYASPISEMGILFYN
    2 FSLTFHEGKVVDF--DAG-EGYDALKQLLDTD-EGSKSLGEVALVPYASPISEMGILFYN
    3 FSLTFHDGKVIAF--EAE-KGAEFLKNLIETD-EGSHRLGEVALVPYDSPISNTGILFYD
    4 FALTFKDGKVVGY--HAE-QGFDALKSLVEAN-PGSNMLGEISFVPYDSPIQNLGILFYN
    5 FSLTFKDGKVVSY--QAE-TGEEALKNLIEAS-EGSNYLGEISFVPYHSPISDMDTLFYN
    6 FSMTFKNGKIVDF--SAE-KGYETLKSIIETD-EGSHFLGEVALVPFDSPISNSKILFYN
    7 FSLTFKDGKIIDY--NAE-KGRETLKTIIETD-QGSHFLGEVALVPYDSPISNSKILFYN
    8 LSLTFEEGRIVDF--QAE-KGFETLKTLIETD-EGSHYLGEVALVPYDSPISNSKLLFYN
    9 FSFTFKDGKIIDF--SAQ-KGYETLKNLIETD-EGAYYLGEVALVPFDSPISNSKILFYN
   10 FSFTFKEGRIVDF--SAE-KGYEALKNLIETD-EGSHYLGEVALVPYDSPISNSKILFYN
   11 FTLTFKDGRVIDY--SAE-EGLESLKGLITTD-EGSHYLGEVALVPYDSPISNAKILFYN
   12 FTLTFKDGRVIDY--SAE-EGLENLKGLITTD-EGSHYLGEVALVPYNSPISNSKILFYN
   13 FSLTFKDGRIIDF--SAE-EGLESLAALVNTD-EGSHYLGEVALVPDNSPISNSKILFYN
   14 FSLTFQQGKVVDF--QAE-KGYEVLQQLIHTD-EGARYLGEVALVPYDSPLSRANILFLN
   15 FTLTFKDGKIVDF--TCE-KGYDNLKNLIETD-EGTHYLGEVALVPFDSPISNSNILFYN
   16 FSLTFKYGKIISF--TCK-KGYETLKNLIETD-EGSHYLGEVALVPFNSPISNSNILFYN
   17 FSLTFKNGEVVDY--SAE-IGYESLKSLIETD-EGSRYLGEVALVPYDSPISKSGVLFYN
   18 FYITFKDGKIVDF--HAK-KGYDALKHLINTD-EGSHYLGEVALVPFDSPISNSNIIFYN
   19 FSVTFKDGKVVDF--SAE-KGYDTLKHLLDTD-EGAKYLGEVALVPYNSPISNSGIIFFN
   20 FSLTFKDGKVVDF--SAK-KGKETLEQLLKSD-EGSSYLGEVALVPYDSPISNSNTIFYN
   21 FSLTFKEGKVVDF--SAE-KGKEILKQLLKSD-EGSSYLGEVALVPYDSPISNSNTIFYN
   22 FSLTFKEGKVVDF--SAE-KGKEILEKLLKSD-EGSSYLGEVALVPYDSPISNSNTIFYN
   23 FTLRFVEGKVVEY--SAQ-TGEEILGKLLDMD-EGARYLGEVALVEYNSPISKSEKVFYN
   24 FILKFKNGKIIDF--SAE-EGYETLKKLIETD-EGSCYLGEVALVPFHSPISDSNIIFYN
   25 FTLKFENGRIIDF--SAE-EGYETLKKLIETD-EGSCYLGEVALVPFHSPISDSNIIFYN
   26 FKLTFKDGRIIEV--EAD-TGLETLKKLIDTD-EGSHYLGEVALVPYDSPINNTGIVFYN
   27 FKLTFKDGKIVDF--TAE-KGEEILKGLLDTD-EGARYLGEVALVGYNSPISNSGLIFYN
   28 FKLTLKDGKIVDF--TAE-KGEEILKGLLYTD-EGARYLGEVALVGYNSPISNSGLIFFN
   29 FWLRFENGRVVDF--AAK-KGEAILKGLIETD-EGSHFLGEVALVPYDSPISQSGVLFYN
   30 FKLTFKDGKVVDY--GAE-KGGEILKGLLETD-EGASYLGEVALVPFDSPISQSGILFYN
   31 FSLTFKDGKVVDY--KAE-RGAEILKELFSTD-EGASYLGEVALVPYDSPISKSGVLFFN
   32 FTLTFEAGQVVSY--KAE-QGEEHLKELLHTD-EGASFLGEVALVPYDSPISQSGILFYN
   33 FTLRFHEGKVVEY--KAQ-QGEEHLKELLHTD-EGASFLGEAALVPHDSPISKSGILFYN
   34 FSLTFRAGKVTDY--HAE-NGEEYLRELLQTD-EGASFLGEAALVPHASPISASGILFYN
   35 FSLTFRAGKVTDY--HAE-SGEEHLRELLQTD-EGAPFLGEVALVPHASPISASGILFYN
   36 FTLTFRDGKVVDY--TAR-KGGEQLKELLETD-EGASFLGEVALVPHTSPISQSGILFYN
   37 FTLTFRDGKVVDY--TAR-KGGEQLKELLETD-EGASFLGEVALVPHTSPISQSGILFYN
   38 IRLTFRDGKVVDH--MAS-RGAEHLKKLIETD-EGASFLGEVALVPYDSSISRSNILFYN
   39 IRLTFRDGKVVDH--TAS-RGAEHLKKLIETD-EGASFLGEVALVPYDSPISRSNILFYN
   40 FSLTFKNGKVVAC--SAE-TGLDILTELLNTD-EGSRYLGEVALVPYNSPISNSNIIFYN
   41 FSITFKDGKVIDC--SAE-TGLDVLKEIIKTD-ENSCRLGEVALVPYDSPISNSNIIFFN
   42 FSLTFKDGKVIDC--SAK-EGLDVLKELLNTD-EGSKHLGEVALVPYDSPISNSNIIFYN
   43 FSLTFKDGKVVDF--NAE-EGYESLKELLASD-DGASYLGEVALVPFDSPISNSNIIFYN
   44 FSFTFKDGKIVDF--DAA-IGKAVLEKLIETD-EGACYLGEVAIVPESSPVSKTNTIFFN
   45 FHFVVKNGKIVEA--RAE-KGEETLKAAISVD-EGASYFGEVALVPYDSPISNQKILYYN
   46 FTLTFEKGRIVDF--TAE-KGYATLQKLIDTD-EGSHYLGEIALVPHDSPISNTNIIFYN
   47 FSLTFKDGKVTDF--HAE-EGYETLKGLLETD-EGASFLGEIALVPHNSPISNTNIIFNN
   48 FSLTFKEGRIVDY--SAE-QGLDTLRQIIETD-EGSHYLGEVSLVPHHSPISDTNLIFYN
   49 FTLTFENGRIVDY--KAE-AGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNVLFYN
   50 FTLTFENGRIVDY--KAE-AGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNVLFYN
   51 FTLTFENGRIVDY--KAE-VGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   52 FTLTFENGRIVDY--KAE-VGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   53 FTLTFENGRIVDY--KAE-VGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   54 FTLTFENGRIVDY--KAE-VGEEALKHLVETD-KGSHFLGEVALVPHDSPISNTNILFYN
   55 FTLTFENGRIVDY--KAE-VGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   56 FTLTFENGRIVDY--KAE-TGEESLKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   57 FTLTFENGRIVDY--KAE-SGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   58 FTLTFENGRIVDY--KAE-SGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   59 FTLTFENGRIVDY--KAE-SGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   60 FTLTFENGRIVDY--KAD-VGEEALKHLVETD-EGSHFLGEVALVPHDSPISNTNILFYN
   61 FTLTFENGRIVDY--KAD-VGEEALKHLIETD-EGSHFLGEVALVPHDSPISNTNILFYN
   62 FTLTFENGKIVDV--NAE-EGEETLKHLIETD-EGAKYLGEVALVPHQSPISQSNIIFYN
   63 FTLTFKNGRIIDI--KAE-QGEDILKELVEAD-EGSHYLGEVALVPYDSPISQSNILFYN
   64 FTLTFENGRIVDI--KAE-KGEDILKELVETD-EGSHYLGEVALVPYDSPISQSNILFYN
   65 FTLTFKNGRIVDI--KAE-KGEDILKELVETD-EGSHYLGEVALVPYDSPISKSDILFFN
   66 FTLTFENGRIVDV--KAE-KGEEILKGIVETD-EGSHYLGEVALVPYDSPISQSNILFYN
   67 FTLTFENGRIVDV--KAE-KGEEILKGIVETD-EGSHYLGEVALVPYDSPISQSNILFYN
   68 FTLTFKNGRITDV--KAG-QGEEILKELIETD-EGSHYLGEIALVAHDSPISKSNILFYN
   69 FTLTFKNGRITDV--KAE-QGEEILKELIETD-EGSHYLGEIALVAHDSPISKSNILFYN
   70 FTLTFKNGRITDV--KAE-QGEEILKELIETD-EGSHYLGEIALVAHDSPISKSNILFYN
   71 FTLTFENGRIVDV--KAK-EGEDILTSLVETD-EGSHYLGEVALVPDDSPISNSNILYYN
   72 FTITFENGRIVDV--KAE-EGEEILKQLVETD-EGSHYLGEVALVPFNSPISQSNLLFYN
   73 FSLTFENGRIIDV--KAE-EGEEILKQLVETD-EGSHYLGEVALVPFNSPISQSNLLFYN
   74 FSLTFENGRIVSV--KAK-VGEEILKHLIETD-EGSHYLGEVALVPFNSPISQSNILFYN
   75 FTLTFENGRIVEV--KAE-EGEEILKRLIDTD-EGSHYLGEVALVPHNSPISQSNILFYN
   76 FKLTFKEGRIVEV--QAE-EGEDILKRLVETD-EGSHYLGEVALVPHQSPISQSNILFYN
   77 FTITFKNGRIVDV--KAK-EGEEILKKLVETD-EGSHYLGEIALVPHHSPISESGILFYN
   78 FTLTFEKGRIVSA--TAE-KGEESLKQLIETD-EGSHYLGEVALVPHLSPISQSNIIFYN
   79 FKLTFENGRIVQV--EAA-QGEEVLKNLVATD-EGSHYLGEVALVPFHSPISQSNILFYN
   80 FKITFKDGKIVDA--TAA-QGEDVLKQLIATD-EGSHFLGEVALVPHQSPISDSNILFYN
   81 FKITFKDGAITDV--SAE-QGEEILKQLIDTD-EGAKFLGEVALVPHDSPISNSNILFYN
   82 FTLTFKDGRIIDV--KAE-EGQEILASLIETD-EGAHYLGEIALVPHHSPISQSNLLFYN
   83 FTLTFKDGRIIEV--KAE-EGQEILASLIETD-EGAHYLGEIALVPHQSPISQSNLLFYN
   84 FTLTFKDGRIIDV--KAE-QGQEILASLIETD-EGAHYLGEIALVPHQSPISQSDLLFYN
   85 FKLTFENGRIVQV--EAE-QGQEILQHLVDTD-EGSHYLGEVALVPHHSPISESNILFYN
   86 FKLTFENGRIVKV--EAE-QGQEILQQLVDSD-EGSHYLGEVALVPHESPISQSNTLFFN
   87 FKITFEAGRIVKV--EAE-QGQETLQRLVDTD-EGSHYLGEVALVPHESPISQSNILFYN
   88 FKITFENGRIVTA--EAQ-QGQDILQQLVETD-EGSHYLGEVALVPHESAISQSNILFYN
   89 FSLTFAEGKVVSF--TAE-QGYETLERLLNMD-EGARYLGEVALVPHQSPISESNILYYN
   90 FSLTFAEGKVVSF--TAE-QGYETLERLLNMD-EGARYLGEVALVPHQSPISESNILYYN
   91 FSLTFEAGKVVSF--TAE-QGYETLERLLNMD-DGARYLGEVALVPHQSPISESNILYYN
   92 FSLTFENGKVVSF--TAE-QGYETLERLLNMD-EGARYLGEVALVPHQSPISESNILYYN
   93 FTLTFENGRIVDV--QAE-TGLETLQHLVEMD-EGSHYLGEVALVPHQSPISDKNILFYN
   94 FSLTFENGRIVDV--QAE-TGLETLQHLVEMD-EGSHYLGEVALVPHKSPISDKNILFYN
   95 FSLTFENGRIVDV--QAE-TGLETLQHLVEMD-EGSHYLGEVALVPHKSPISDKNLLFYN
   96 FSLTFENGRIVDY--KAE-VGADVLKQLVDLD-EGSHYLGEVALVPHNSPISQSGILFYN
   97 FKLTFENGKIVDV--SAE-QGEDTLRTLIDMD-EGARYLGEVALVPHESPISQSGLLFYN
   98 FSITFENGRIVDF--SAE-QGQDTLTRLISMD-EGSHYLGEVALVPHRSPISESGILYYN
   99 FSITFEKGRIVDF--SAE-QGQDTLTRLISMD-EGSHYLGEVALVPHRSPISESGILYYN
  100 FSLTFENGRIVNF--SAE-QGEDTLSRLISMD-EGSHYLGEVALVPYRSPISESGILYYN
  101 FSITFENGRIVDF--SAE-QGEDTLSRLVSMD-EGSHYLGEVALVPYRSPISESGILYYN
  102 FSITFENGKIVSF--EAE-EGNETLQKLIETD-EGSQYLGEVALVPHDSPISNTNLIFYN
  103 FSLTFKDGKVVDF--KAE-QGEATLQRLLDSD-EGARYIGEVALVPHKSPISDTNILFYN
  104 FTLTFKDGKVVDF--TAE-QGYETLKRLLDTD-EGARYIGEVALVPHQSPISETDLIFYN
  105 FTLTFKNGKVVDF--SAE-RGEETLKRLLDSD-EGARYIGEVALVPHRSPISDTNLIFYN
  106 FSLTFENGKVVAF--SAK-EGEETLKHLLDTD-EGARYLGEVALVPHSSPISQSGILFYN
  107 FTLTFKDGKVVDF--KAE-QGEETLKNLLDSD-EGAKRLGEVALVPHGSPISQSGILFYN
  108 FKITFEKGRIVEV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  109 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  110 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  111 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  112 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  113 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  114 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  115 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  116 FKITFEKGRIVGV--EAA-SGEEILKDLIATD-EGSHYLGEVALVPDPSPISQSGILFYN
  117 FTITFEEGRIVDV--KAE-QGEEILKNLIETD-EGSHYLGEVALVPDPSPISQSGILFYN
  118 FKLTFENGRISNV--EAE-KGKEILQDLVNTD-EGSHYLGEVALVPDPSPISQSGILFYN
  119 FTLWFEGGKVVKA--EAK-KGQAALDELLNMD-EGARRIGEVALVPDDSPISNSGLLFYN
  120 FTLWFEDGKIVKA--EAK-QGQAALDELISLD-EGARYLGEVALVPHHSPISDSGILFYN
  121 FTLTFKDGQVVDF--SAE-QGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  122 FTLTFKDGQVVDF--SAE-QGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  123 FTLTFKDGQVVDF--SAE-QGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  124 FTLTFKDGQVVDF--SAE-QGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  125 FTLTFKDGQVVDF--SAE-QGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  126 FTLTFKDGQVVDF--SAE-QGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  127 FTLTFKDGQVVDF--SAE-EGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  128 FTLTFKDGQVVDF--SAE-EGYETLKHLLDTD-DGARRLGEVALVPHQSPVSLSNLIFYN
  129 FTLTFKNGKVVDF--TAE-KGYEILKHLLDTD-EGARRLGEVALVPHQSPISASNLIFYN
  130 FTLTFKNGKVVDF--TAE-KGYEILKHLLDTD-EGARRLGEVALVPHQSPISASNLIFYN
  131 FTLTFKDGKVVDF--TAE-KGYEILKHLLDTD-EGARRLGEVALVPHQSPISTSNLIFYN
  132 FTLTFKDGKVVDF--TAE-VGYDTLKHLLDTD-EGARRLGEIALVPHRSPISQSNLVFYN
  133 FSLTFKDGKVVDF--SAD-KGYEMLKRLLDTD-EGARKLGEVALVPHESPISNTNLIFYN
  134 FTLTFKSGKVVDY--SAE-SGEDTLKHLLDTD-DGAKQLGEVALVPNESPISKSGHIFFN
  135 FSLTFKDGKVVDY--KAE-QGEETLKHLLETD-EGASRLGEVALVPHESPVSQSGLIFYN
  136 FSLTFKDGKVVDF--KAE-TGEDTLKHLLETD-EGASRLGEIALVPHESPVSQSGLIFYN
  137 FTLTFKDGKVVDY--KAE-QGEAVLKHLLDSD-EGAVRLGEIALVPHESPVSQSGLIFYN
  138 FTLTFKEGKVTDF--SAE-EGEETLKHLLDTD-EGSRRLGELALVPHESPISQSGLIFYN
  139 FSLTFENGKVVKC--TAE-QGQEPLQRLIATD-EGAARLGEVALVPQNSPIAEMNVLFYN
  140 FSLTFADGRVVDF--QAE-KGYESLKAMLDLD-EHSRYLGEAALVPHRSPISDSNIIFFN
  141 FSFTFENGRVVDF--KAE-QGEEAIKGLLDTD-DAAKFLGEVALVPHKSPISDSNILFYK
  142 FKLTFKEGKIIKA--EAE-VGQDLLQELIQVD-EGSSYLGEVALVPHESPISASEILYFN
  143 FKLTFKEGKIIKA--EAE-VGQDLLQELIQVD-EGSSYLGEVALVPHESPISASGILYFN
  144 FKLTFEEGKIIKA--EAE-VGHDLLQELIQVD-EGSSYLGEVALVPHESPISASEILYFN
  145 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEVALVPHESPISASGILYFN
  146 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEVALVPHESPISASGILYFN
  147 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEIALVPNESPISASGILYFN
  148 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEIALVPNESPISASGILYFN
  149 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEVALVPHESPISASGILYFN
  150 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEVALVPHESPISASGILYFN
  151 FKLTFEEGKIVKA--EAQ-VGHDLLQELINVD-EGSCYLGEVALVPHESPISASGILYFN
  152 FKLTFEKGKIVNV--EAK-VGQDLLKQLIASD-EGSSYLGEVALVPHESPISSSNILYYN
  153 FTLTFEKGKIVEA--KAE-IGQELLNEMISAD-EGAAYLGEVALVPHHSPISDSNILFYN
  154 FSLTFEGGKVVSY--TAE-VGLEYLDALLKTD-EGAKYLGEVALVPHHSPISNLNRVFYN
  155 FKLTFKDGVVVDY--SAE-VGQEHLKSLFDTD-EGAKRLGEVALVPHDSPISNLNRIFYN
  156 IKLTFKDGKVIAY--EAE-SGREHLTTLLETD-EGASYLGEMALVPHDSPISQLNRVFYN
  157 MKLTFKDGKVVAY--EAE-SGREHLTTLLETD-EGASYLGEMALVPHDSPISQLNRVFYN
  158 IKLTFKDGKVVEY--EAE-SGREHLTTLLDTD-EGASYLGEMALVPHDSPISQLNRVFYN
  159 LKLTFKDGKVVEY--DAE-AGREHLTTLLETD-DGASYLGEMALVPHDSPISKLNRVFYN
  160 ITFTFKDGKVTEY--TAE-SGEQHLTHLLATD-EGASYLGEVALVPHDSPISNLNRIFYN
  161 ITFTFKDGKVTQY--TAE-SGEQHLTHLLATD-EGASYLGEVALVPHDSPISNLNRIFYN
  162 ITFTFKDGKITEY--TAE-SGEQHLTHLLATD-EGASYLGEVALVPHDSPISNLNRIFYN
  163 ITFTFKDGKVTEY--TAE-SGELHLTHLLATD-EGACYLGEVALVPHDSPISNLNRIFYN
  164 FFLTFKDGKIIDF--SAE-KGLDTLEKLIETD-EGSHYLGEVALVPYNSPISNTDIIFYN
  165 FVLKFEKGRIVDF--TAK-EGEETLRHLIETD-EGSHYLGEIALVPYSSPISDTNTVFYN
  166 FTITFENGKIVDF--TAE-KGYETLKNLIETD-EGSHYIGEVALVPYNSPISNTNTVFYT
  167 FWIRFEEGKIVDY--DAK-IGKENLKNLVETD-EGSLRLGEIALVPYDSPISNRNIIFYS
  168 FWIRYEAGKVVDF--DAK-KGKENLKNLIETD-EGSFRLGEVALVPYDSPISNKDIVFYT
  169 LSLTFKEGRIISV--NAK-EGEELLNHLIDTD-EGAHYLGEVALVPNDSPISQSGLVFYT
  170 FSLTFKDGEVVDF--TAE-KGADALRHLLESD-PNARRLGEVALVPHHSPVSESGLVFYN
  171 MKFTFKDGKVVDF--SAE-QGEEVLAKLLAID-EGAKHLGEVALVPDPSPISQSGIIFFN
  172 MKFTFKDGKVVDF--SAE-QGEEVLAKLLAID-EGAKHLGEVALVPDPSPISQSGIIFFN
  173 MKFTFKDGKVVDF--SAE-QGEEVLGKLLAID-EGAKSLGEVALVPDPSPISQSGIIFFN
  174 MKFTFKDGKVVDF--SAE-QGEEALKNLLAID-EGAKHLGEVALVPDPSPISQSGLIFYN
  175 MKFTFKDGKVVDF--SAE-QGEEALKNLLAID-EGAKHLGEVALVPDPSPISQSGLIFYN
  176 MKFTFKDGKVVDF--SAE-QGEEALKNLLAID-EGAKHLGEVALVPDPSPISQSGLIFYN
  177 MKFTFKDGKVVDF--SAE-QGEEALKNLLAID-EGAKHLGEVALVPDPSPISQSGLIFYN
  178 MKFTFKDGKVVDF--SAE-QGEEALKNLLAID-EGAKHLGEVALVPDPSPISQSGLIFYN
  179 MKFTFKDGKVVDF--SAE-QGEDVLAKLLDTD-EGARRLGEVALVPDPSPISQSGIIFFN
  180 MKFTFKDGKVIDF--SAE-KGQDVLENLLETD-EGAKSLGEVALVPDPSPISQSGIIFFN
  181 MQFTFKDGKVIDY--SAE-QGQETLASLLSID-EGAKHLGEVALVPNQSPISQSGLTFFN
  182 MEFTFKDGKVVNV--TAE-QGKEVLKNLVATD-EGSARLGEVALVPDPSPISQSGIVFFN
  183 MEFIFKDGKVINV--TAE-QGESVLKNLVATD-AGSARLGEVALVPDPSPISQSGIVFYN
  184 MEFEFKDGKVVSF--SAD-KGQDVIEKLLEQD-EGASRLGEVALVPHESPISQSGLTFFN
  185 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  186 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  187 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  188 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  189 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  190 IKVTFKDGQIIDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  191 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  192 IKVTFKDGEIIDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  193 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  194 IKVTFKDGQIVDI--SAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  195 IKVTFKDGQIVDI--TAE-KG---------------------------------------
  196 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  197 IKVTFKDGQIVDI--SAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  198 IKVTFENGQIVDI--TAE-KGDQVMKDLVFKN-AGARALGECALVPDPSPISQSGITFFN
  199 IKVTFENGQIVDI--TAE-KGDQVMKDLVFKN-AGARALGECALVPDPSPISQSGITFFN
  200 ITVTFKEGQIVDI--TAE-KGDQVMKDLVFEN-MGARALGECALVPDPSPISQSGITFFN
  201 IKVTFKDGQIVDI--TAK-KGDQVMKDLVSKN-AGARALGECALVPDPSPISQSGITFFN
  202 IKVTFENGEIVDI--TAE-KGDQVMKDLVFKN-KGARALGECALVPDPSPISQSGITFFN
  203 IKVTFENGEIVDI--TAE-KGDQVMKDLVFKN-KGARALGECALVPDPSPISQSGITFFN
  204 IKVTFENGEIVDI--TAE-KGDQVMKDLVFKN-KGARALGECALVPDPSPISQSGITFFN
  205 IKVTFENGEIVDI--TAE-KGDQVMKDLVFKN-KGARALGECALVPDPSPISQSGITFFN
  206 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  207 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  208 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  209 IKVTFKDGRIVDI--TAE-KGDQVMKDLVFEN-AGARALGEVALVPDPSPISQSGITFFN
  210 IKVTFKDGQIVDI--TAE-KGDQVMKDLVFEN-AGARALGECALVPDPSPISQSGITFFN
  211 IKMTFKDGQIVDI--TAE-KGDQVMKNLVFEN-AGARALGECALVPDPSPISQSGITFFN
  212 IKVTFKDGEIVDI--TAD-QGDEVMKNLVFNN-NGARALGECALVPDPSPISQSGITFFN
  213 IKVTFKDGEIVDV--TAD-QGDEVMKNLVFNN-NGARALGECALVPDPSPISQSGITFFN
  214 IKVTFKDGEIVDI--TAD-QGDEVMKNLVFNN-NGARALGECALVPDPSPISQSGITFFN
  215 IKVTFKDGEIVDI--TAD-QGEKVMKNLVFNN-NGARALGECALVPDSSPISQSGITFFN
  216 IKVTFKDGEIVDI--TAD-QGEKVMKNLVFNN-NGARALGECALVPDSSPISQSGITFFN
  217 IKVTFKDGEIVDV--TAE-KGDEVMKKLVFDN-AGARGLGEVALVPDKSPISQSGVTFFN
  218 IKVTFKDGQITEV--SAE-KGDQVMKDLVFEN-NGARGLGEVALVSDPSPISQSGITFFN
  219 IKVTFKDGQIVEV--SAE-KGDQVMKDLVFEN-MGARGLGEVALVSDPSPISQSGITFFN
  220 IVVHFKDGKIVDI--SAE-KGEEAIKKLVFEN-EGATGLGEVALVPDPSPISQSGITFFN
  221 MTFTFKDGQITEV--TAQ-KGEETIKRLVEEN-DGARSLGEVALVPHKTPISLSGLTFFN
  222 MRFTFKDGQITEV--TAK-KGEETIKRLVEEN-DGARSLGEVALVPHKTPISLSGLTFFN
  223 MKFTFKDGQIVDV--TAK-KGEETIKRLVEEN-DGARALGEVALVPHKTPISLSGLTFFN
  224 MKFTFKDGQIVDV--TAK-KGEETIKRLVEEN-DGARALGEVALVPHKTPISLSGLTFFN
  225 MTFTFKDGQIVEV--TAK-KGEETVKRLVEEN-DGARALGEVALVPHKTPISLSGLTFFN
  226 MTFTFKDGKIVDV--TAK-KGLETIKRLVEEN-EGARSLGEVALVPHKTPISLSGLTFFN
  227 MKFTFKDGKITEV--TAE-KGEETIKRLVEEN-DGARSLGEVALVPHKTPISLSGLTFFN
  228 MTFTFKDGQIVDV--TAK-KGEDTIKRLISEN-EGARSLGEVALVPHKTPISLSGLTFFN
  229 MTFTFKDGQIVDV--KAE-KGQETLERLISEN-EGARSLGEVALVPHKTPISLSGLTFFN
  230 MTFTFKDGKIINV--TAE-KGQETVQRLIEEN-DGARSLGEVALVPHKTPISLSGLIFFN
  231 MKFTFKDGKVVEA--SAS-EGEETLIKLIEEN-EGSASLGEVALVPHQSPISQSGIIFFN
  232 MKFYFEDGKVTKV--EAS-QGQATLEKLVEEN-DGARSLGEVALVPHKSPISQSNIIFFN
  233 MKFTFKDGQIVEV--SAE-KGEETLKRLVEEN-EGARGLGEVALVAHKTPISQSGITFFN
  234 IKVTFADGKIVDV--TAD-KGEQIMKDLVFNN-DGAQGLGEVALVPHQSPISQSNLTFYN
  235 MHFEFENGKVTKV--TAD-KGQNILEELIKTD-DGATSLGEVSLVPDPSPISQSGITFFN
  236 MHFEFENGKVTKV--TAD-KGQNILEELIKTD-DGATSLGEVSLVPDPSPISQSGITFFN
  237 IKFTFKAGHVTKI--EAS-SGQDILEHLVETD-AGASSLGEVALVPDPSPISRSGIVFFN
  238 MKFTFKDGKVVEA--TAK-KGQEVLKHLLETD-AGAKSLGEVSLVPDPSPISQSGIIFFN
  239 MEFTFKDGQVVKA--TAK-KGQKTLDHLLQTD-PGVRSLGEVSLVPDPSPISQSGIIFYN
  240 MRFSFKDGKVVEA--TAE-KGQDVLDELL-KN-AGADSLGEVSLVPDESPISQSGIIFYN
  241 MHFTFKDGQIVEA--HAK-QGDDVLQNLLKT--PGARSLGEVSLVPDPSPISQSGLIFFN
  242 MQFTFKNGQVVNA--HAD-RGNDVLQNLLKT--PGARSLGEVSLVPDPSPISQSGLIFFN
  243 MHFTFKNGQVVDA--HAD-RGDAVLQNLLKI--PGARSLGEVSLVPDPSPISQSGLIFFN
  244 MHFTFKNGQVVDA--HAD-RGDTVLQNLLKI--PGARSLGEVSLVPDPSPISQSGLIFFN
  245 MHFTFKDGQVVDA--HAD-RGDTVLQNLLKI--PGARSLGEVSLVPDPSPISQSGLIFFN
  246 MQFTFENGKVVKA--TAE-EGNDVLQKLLQTD-AGVKSLGEVALVPDPSPISQSKITFYN
  247 MQFTFENGRVIKA--TAE-EGNDVLQKLLQTD-EGVKSLGEVALVPDPSPISQSKITFYN
  248 MVFTFTNGRITAA--HAD-HGQSALDHLLATD-AGAQHLGELALVPEATPIARSGLIFYN
  249 IKLTFADGQVVAA--EAT-SGQDVLQQLIQTD-AGAASLGEVSLVPDNSPISNSDIVFYT
  250 IKLTFADGKVVSA--EAT-TGQDVLQQLIQTD-AGAASLGEVSLVPDDSPISNSDIVFYT
  251 IKLTFVDGHVTEA--HAS-TGEAVLQQLIKTD-EGASSLGEVSLVPDPSPISQSGIVFYN
  252 IELTFEDGQVTKA--TAS-SGSDVLQHLIQSD-DGAKSLGEVSLVPNPSPISQSGIIFYN
  253 IALDFENGRIVKA--TAT-KGQDVLEKLLATD-DGAKSLGEVSLVPDPSPIAQGGVLFYN
  254 IALDFENGRIVKA--SAT-KGQDVLEKLLSTD-DGAKSLGEVSLVPDPSPIAQGGVLFYN
  255 IELDFENGRIVKA--SAS-KGLPVLQKLIDTD-EGAKSLGEVSLVPDPSPIAQGGVLFYN
  256 ITLDFENGRIVKA--TAT-KGRDVLEKLIATD-DGSKSLGEVSLVPDPSPIAQGGVLFYN
  257 ITLDFENGRIVKA--TAT-KGRDVLEKLIATD-DGSKSLGEVSLVPDPSPIAQGGVLFYN
  258 IELDFEDGRIVKA--QAT-SGLDVLEKIINTD-EGSKSLGEVSLVPDPSPIAQSGILFYN
  259 IALDFKDGRIIDA--TAT-RGENVLKQLIETD-DGSKSLGEVSLVPDPSPISQSGILFYN
  260 IALDFKDGRIVKA--TAT-KGMAILQKIIDTD-EGAKSLGEVSLVPHPSPISQSGILFYN
  261 IVLQVKNGQIVKA--QAS-SGEAVLKDLIATD-TGSHSFGEVSLVPFHSPINDAGVLFYN
  262 IHLTFRNGRVVEG--IAD-QGNETLQHILDTD-DGTRSLGEISLVPDDSPISNSNITFFS
  263 IHLTFERGKVIKA--AAD-RGEEVLLHLLQTD-DGAKSLGEISLVPDDSPISQSNTIFFN
  264 FKLTFKNGKVVDF--EAE-QGYEILKQLLDTD-EGSRRIGEVALVPNDSPISNSGLLYYQ
  265 FKLTFKDGKVVDF--EAE-QGYEILKQLLDTD-EGSRRIGEVALVPNDSPISNSGLLYYQ
  266 FKLTFKDGKVVDF--QAE-TGYDILKQLLDTD-EGAKSIGEVALVPHDSPISNSGLLYYQ
  267 FKLTFKDGQVVDF--EAQ-TGQDILEGLLNTD-DAAKYLGEVALVPHDSPISNSKILYYN
  268 FTLTFKDGEIIDV--KAE-KGEAVLKDLIETD-EGSRRLGEVALVPDDSPISNRRTIFYN
  269 FTLTFKDGEIIDV--KAE-KGEAVLKDLIGTD-EGSRRLGEVALVPDDSPISNRRTIFYN
  270 FTLTFKDGEIVEV--KAE-KGEEVLKDLINTD-EGSRRLGEVALVPDDSPISNRRTIFYN
  271 FTLTFKDGVIIDV--KAE-KGEKLLKDLIATD-EGACRLGEVALVPDDSPISNRRTIFYN
  272 FTLTFKDGVIIDV--KAE-KGEKLLKDLIATD-EGACRLGEVALVPDDSPISNRRTIFYN
  273 FTLTFKDGVIIDV--KAE-KGEKLLKDLIATD-EGACRLGEVALVPDDSPISNRRTIFYN
  274 FTLTFKNGEIIDV--KAE-KGEEVLKDLISTD-EGSKRLGEVALVPDDSPISNRNTIFYN
  275 FTLTFKDGEVIDF--KAD-KGEDVLRDLLDTD-EGAKRLGEVALVPDDSPISNRNTIFYN
  276 FTLTFKDGVIVDF--KAD-KGEDVLRDLLDTD-EGARRLGEVALVPDDSPISNRNTIFYN
  277 FTLTFKDGQIVDF--KAD-KGEDMLRDLINTD-EGSKRLGEVALVPDDSPISNRNTIFYN
  278 FKLMFKDGEIIDF--SAE-KGEAVLKDLINTD-EGSRRLGEVALVPDDSPISNRNTIFYN
  279 FKLMFKDGEIIDF--SAE-KGEAVLKDLINTD-EGSRRLGEVALVPDDSPISNRNTIFYN
  280 FKLMFKDGEIIDF--SAE-KGEAVLKDLINTD-EGSRRLGEVALVPDDSPISNRNTIFYN
  281 FKLMFKDGEIIDF--SAE-KGEAVLKDLINTD-EGSRRLGEVALVPDDSPISNRNTIFYN
  282 FKLNFKDGVITDF--SAE-QGEAVLNDLINTD-EGSRRLGEVALVPDDSPISNRNTIFYN
  283 FTLTFKEGVIVDI--KAE-QGEDVLRDLINTD-EGSKRLGEVALVPDDSPISNRNTIFYN
  284 FTLTFENGEIIRV--QAQ-QGEEVLKDLINTD-EGSKYLGEVALVPYDSPISNKNTIFYN
  285 FTLTFKDGAVVDF--KAE-KGESVLRDLLNTD-EGAKRLGEVALVPDDSPISNRNTIYYN
  286 FTLTFKDGEVVDF--KAD-QGEDVLRDLLNTD-EGARRLGEVALVPDDSPISNRNTIFYN
  287 FTLTFKDGEVVDF--KAE-QGESVLRDLLNTD-DGAKRLGEVALVPDDSPISNRNTVFYN
  288 FTLTFKDGKVIDF--TAE-KGEDVLRNLLETD-EGSKYLGEVALVPDDSPISNRNRVFYN
  289 FKLTFKDGAVVDF--EAK-QGEAVLADLLDTD-EGARRLGEVALVPDDSPISNKNTIFFN
  290 FWVEFKDGVVVDF--DAK-VGKSALENILNQDGDKSKRLGEVALVPYDSPISNSNVLFYN
  291 FWLRFKDGAVVDF--DAK-VGKETLQSIFDKD-ERARKLGEVALVPYDSPISNSNILFYN
  292 FWLRFKDGAVVDF--DAK-VGKETLQSIFDKD-ERARKLGEVALVPYDSPISNSNILFYN
  293 MRFEFKNGKVVDF--DAE-VGKETLKNMFDTD-ENGKYLGEVALVPYESPISKSNVTFIK
  294 MRFEFKDGKVVDF--DAE-VGKETLKNMFDTD-ENGKYLGEVALVPYESPISKSNVTFIK
  295 MRFEFKDGKVVDF--DAE-VGKETLKNMFDTD-ENGKYLGEVALVPYESPISKSNVTFIK
  296 FKLEFENGKVVKY--EAK-KGYEVLKSLLETD-EGALSLGEVALVPFDSPISNTNTMFFE
  297 FKLEFENGKVINY--EAK-KGYEVLKSLLETD-EGALSLGEVALVPFDSPISNTNTMFFE
  298 FKLEFKNGKVVSY--EAK-KGYGVLKSLLETD-EGALSLGEVALVPFDSPISNTNTMFFE
  299 FKLKFEEGKVVEF--DAK-EGRDILAKLIDTD-EGSKRLGEVALVPYDSPISNTNLLFYN
  300 FYLKFKDGVVVDF--DAK-IGYETLKNMLDSD-EGSRRLGEVALVPYHSPISNTKILFYN
  301 FYLKFENGKVIDF--DAK-EGYETLKNLLETD-EGASRIGEVALVPYDSPISNSGILFFE
  302 FWFKFEEGKVVDF--GAE-EGYEILKDMLDMD-EGARRLGEVALVPYHSPISMTNILFYE
  303 FYLKFKDGKVIDF--DAE-VGLDELKNILSSA-KDSDRLGEVALVPYDSPISKRNILFFN
  304 FYLKFKDGKVIDF--DAE-VGLDELKNILSSA-KDSDRLGEIALVPYDSPISKRNILFFN
  305 FYLVFKDGEVVDY--DAK-AGKEYLKNILDTD-EGAKRLGEVALVSYNTPISMRKVLFYN
  306 FWLKFEEGKVVDF--GAE-RGYDVLKNLLDTD-EGSRKIGEMALVPFDSPISNTGILFLE
  307 FWLKFEDGKVVDF--GAE-RGYDVLKNLLETD-EGSRRIGEMALVPYDSPISNTKILFLE
  308 FWLKFENGKVVDY--DAK-RGYDALKNILETD-EGARSIGEMALVPFDSPISNTGILFLE
  309 FEFEFKDGKVISF--SAK-EGEDTLREMLDSD-EGSKFLGEIALVPYDSPISNSNILFYN
  310 FEFEFKDGKVVSF--SAK-EGEDTLRKMLDSD-EGSKYLGEIALVPYDSPISNSNILFYN
  311 FEFTFKDGVVIDF--DAK-EGKDTLKKMLESD-EGSKNLGEIALVPYDSPISNSNILFYN
  312 FEFTFENGKVVDF--KAE-EGYDTLKEMLESD-ENAKYLGEIALVPYESPISKSNILFFN
  313 FEFTFENGKVVDF--KAE-EGYDTLKEMLESD-ENAKYLGEIALVPYESPISKSNILFFN
  314 FEFTFENGKVVDF--KAE-EGYDTLKEMLESD-ENAKYLGEIALVPYESPISKSNILFFN
  315 IRLRFENGRIVEY--SAE-KGEEALKAIIEAD-EGSHYLGEVALVPVDSPIAQMNRIFYN
  316 IRLRFEKGKIVET--TAT-RGEEALRHIVETD-EGSRYLGEISLVPVDSPISQRGRLFYN
  317 FWFLFQDGKVIDF--GAE-KGYDTLSSLVHFD-EGSCYLGEVALVPYESPISKSGILFLN
  318 FWFLFQDGKVIDF--GAE-KGYDTLSSLVHFD-EGSCYLGEVALVPYESPISKSGILFLN
  319 FWFLFQDGKVIDF--GAE-KGYDTLSSLVHFD-EGSCYLGEVALVPYESPISKSGILFLN
  320 FWFLFQDGKVIDF--GAE-KGYDTLSSLVHFD-EGSCYLGEVALVPYESPISKSGILFLN
  321 FWFTFQDGRVVDF--GAE-KGYDTLSSLVHFD-EGSCYLGEVALVPYESPISKSGILFLN
  322 FWMEFKDGKVVDF--DAE-EGKDTLSELIHFD-EGSCYLGEVALVPDASPISQSGILFFN
  323 FWMEFKDGKVVDF--DAE-EGKDTLSELIHFD-EGSCYLGEVALVPDASPISQSGILFFN
  324 FWLSFEAGKVVDF--DAK-KGKEALSQLVNFD-AGSCRLGEVALVPHNSPISQSGVLFLN
  325 FWIEFEEGKAVRW--HAE-EEEDALASLIQFD-EGSAYLGEVALIDVDTPISQSGILFYN
  326 FWFRFENGKVVDF--GAK-QEEETLKSLLDFD-EGSRYLGEVALVPYDSPISNSNILFFN
  327 FWFRFENGKVVEY--GAE-KEKEALDKLVHFD-EGSSHLGEVALVPYNSPISQSGILFFN
  328 FWLKFVDGKVVEF--DAK-QERETLEQLLNTD-EGSRHIGEIALISHQSPISDLNILFYN
  329 FWLEFKDGKVVDF--DAR-VEKDALKNILDFD-ANSRYIGEIALISHNSPISNMDILFLN
  330 FTLEFKDGKIVNY--KAE-VGEKILETILNTD-DGAKSLGEVALVPVNSPIYKMKTIFYN
  331 FKLTFKDGEIIKY--EAE-VGKEILETILNTD-KGAKRLGEVALVSVESPIYKMKTVFFN
  332 FTMEFKDGKIVKV--TAE-KGEDVLKQAISLD-EGASYLGEVALVPVDSPIYQLNTIFYN
  333 FWFEFKNGKVVDF--GAA-KGEDVLKELINTD-EGASYLGEVALVDITSPIYQLNRIFYN
  334 FWLEFKDGKVVNF--DAK-KGKDILKELIETD-EGAAYLGEVALVDISSPIYKLGRIFYN
  335 FKFYFENGKIVSF--EAE-KGYATLENLLSSD-EASRYLGEVAIVPVSSPIYKTGLIFYN
  336 FSLTFKEGQVVDF--KAD-VGQDILATLLDSD-DGARRLGEAALIPYNSPISQSNMLFYE
  337 FRLTFKKGKVIRS--HAE-KGDDLLTALLDTD-EGARRLGEVALIPCESPVSLSNTLYYE
  338 FRLTFKNGKVVEA--TAK-KGEEVLKDLLKMD-EGACRLGEVALIPYHSPISLMDTVFYE
  339 FHLTFKDGKVVAA--AAE-TGEDVLKKLIAID-EGACRLGEVALIPYHSPISLSGILFYE
  340 FSLTFQAGKVVAA--DAE-IGNELLQTILQMD-ENACRLGEVALVPYHSPISLSHTLFYE
  341 FSLTFQAGKVVAA--DAE-IGNELLQTILQMD-ENACRLGEVALVPYHSPISLSHTLFYE
  342 FSFTFKEGKIVDY--TAK-EGYEVLKELIETD-EGSHYLGEVALVDHFSPISQSNQIFYE
  343 FSFTFKEGKIVEY--TAK-EGYEVLKELVETD-EGSHYLGEVALVDHFSPISQSNQIFYE
  344 FSFTFKEGKIVEY--TAK-EGYEVLKELVETD-EGSHYLGEVALVDHFSPISQSNQIFFE
  345 FSFTFKEGKIVEY--TAK-EGYEVLKELVETD-EGSHYLGEVALVDHFSPISQSNQIFYE
  346 FSFTFKEGKIVEY--TAK-EGYEVLKELVETD-EGSHYLGEVALVDHFSPISQSNQIFYE
  347 FSFTFKEGKIVEY--TAK-EGYEVLKELVETD-EGSHYLGEVALVDHFSPISQSNQIFYE
  348 FSFTFKSGKIVDY--TAE-EGLDILKELIETD-EGSQYLGEVALVDHYSPISQSNMIYYE
  349 FHMTFRDGKVVDY--DAK-QGREYLTNLIETD-ENSCYLGEVALVDHYSPISQSNMIFFE
  350 FHFTFKDGKVIDF--DAA-QGKDVLRDLLNTD-EGARRLGEVALVGDNSPISNTKILFKN
  351 FHFTFKDGKVIDF--DAK-EGKDVLQSLLDSD-EGARRLGEVALVADDSPISNTGVLFKN
  352 FGFTFKDGKVVDF--YAE-KGYEVLEKLMEND-EGAKYLGEVALVPDDSPISNTGILFNN
  353 FHVTFKDGKVVEH--GAD-EGADLLGQLLDTD-EGARHIGEVALVPASSPINRSGKLFYN
  354 FSVTFKDGEVVEH--SAQ-SGEALLGQLLDTD-EGSRRIGEIALVPASSPINRRGILFYN
  355 WHVTFKDGQVVEH--GAE-KNANLLAELLSTD-ENANRIGEIALVPASSPINRSGVLFFN
  356 IFARFERGFAVEV--RAE-KGEEVLRRLLDTD-EGARRLGEVALVPADNPIAKTGLVFFD
  357 IFARFERGFAVEV--RAE-KGEEVLKRLLDTD-EGARRLGEVALVPADNPIAKTGLVFFD
  358 IFARFERGFAVEV--RAE-KGEEVLRRLLDTD-EGARRLGEVALVPADNPIAKTGLVFFD
  359 IWARFEGGYAVEV--GAK-RGEEVLRRVLSTD-EGARRLGEVALVPADNPIAKTGLVFFD
  360 LWARFEGGVAVEV--GAE-KGEEVLKKLLDTD-EGARRLGEVALVPADNPIAKTGLVFFD
  361 IWARFEGGYAVEV--GAE-KGQEVLLKVLATD-EGARRLGEVALVPADNPIARTGLVFFD
  362 IEVRFEAGRIVEA--KAR-RGEDVFRALIATD-EGASRLGEVALVPDASPVSRSGLIFRN
  363 IEVRFEAGRIVEA--KAR-RGEDVFRALIATD-EGASRLGEVALVPDASPVSRSGLIFRN
  364 IRVRFEGGRIVEA--SAK-VGEDILKELLETD-EGARRLGEVALVPHSSPIAQSGILFYN
  365 IEVRFEKGRVVEA--TAK-SGADVLNRVLQTD-EGAKSLGEVALVPHASPISQSGLLFYN
  366 IAVRFEGGRIVEA--SAR-TGQEVLQKVLETD-EGARRLGEVALVPNSSPISRSGVLFYN
  367 IAVRFEGGRIIEA--KAR-TGADVLNKVLDTD-EGSRRLGEVALVPHSSPISKSGLLFYN
  368 IAVRFEGGRIVEA--QAR-RGGDVLAKVLDTD-EGARRLGEVALVPASSPISASGLLFFN
  369 IAVRFADGRIVEA--TAR-SGADVLARVLDTD-EGARRLGEVALVPASSPISASGLLFFN
  370 IRVRFSEGRIVEA--NAR-TGSDVLAKVLDTD-EGAARLGEVALVPASSAISASGLLFYN
  371 IRVRFSEGRIVEA--NAR-TGSDVLAKVLDTD-EGAARLGEVALVPASSAISASGLLFYN
  372 IRVRFAEGRIVEA--NAR-TGSDVLAKVLDTD-EGAARLGEVALVPASSAISASGLLFYN
  373 IRVRFSEGRIVEA--QAR-TGSDVLAKVLDTD-EGAARLGEVALVPASSAISASGLLFYN
  374 IAVRFEQGRIVEA--NAS-RGADVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  375 IAVRFEQGRIVEA--HAS-RGADVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  376 IAVRFEQGRIVEA--KAS-RGADVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  377 IQVRFEAGRIVEA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISAGGLLFFN
  378 IQVKFEEGRIVEA--KAS-KGEEVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  379 IQVKFEEGRIVEA--KAS-KGEEVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  380 IQVKFEEGRIVEA--KAS-KGEQVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  381 IQVKFEEGRIVEA--KAS-KGEEVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  382 IQVKFEEGRIVEA--KAS-KGAEVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  383 IAVKFEDGRIVEA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISKSGLLFYN
  384 IAVRFEDGRIVDA--KAS-RGAEVLNKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  385 IAVRFEDGRIVDA--KAS-RGAEVLNKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  386 IAVRFEDGRIVDA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  387 IAVRFEDGRIVNA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  388 ISVRFEEGRIVEA--KAS-KGEDVLKKVLDTD-EGARRLGEVALVPHSSPISASGLLFFN
  389 ISVRFEEGRIVEA--KAS-KGENVLKKVLDTD-EGARRLGEVALVPHSSPISASGLLFFN
  390 ISVRFEGGRIVEA--KAS-KGEDVLKKVLDTD-EGARRLGEVALVPHSSPISASGLLFFN
  391 ISVRFEGGRIVEA--KAS-KGEDVLKKVLDTD-EGSRRLGEVALVPHSSPISASGLLFFN
  392 ISVRFEEGRIVEA--KAS-KGEDVLKKVLDTD-EGARRLGEVALVPHSSPISASGLLFFN
  393 IAVEFKDGRIVAA--KAS-RGEEVLNKVLDTD-GGARRLGEVALVPHSSPISHSGLLFFN
  394 IQVRFEGGRIVEA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  395 IQVRFEGGRIVEA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  396 IQVRFEAGRIVEA--KAS-RGEEVLNKVLDTD-EGALRLGEVALVPHSSPISASGILFYN
  397 IQVRFEGGRIVEA--KAT-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  398 IQVRFEGGRIVEA--KAA-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  399 IQVRFEAGRIVEA--RAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISASGVLFYN
  400 IEVRFEGGRIVEA--KAS-RGEEVLKKVLDTD-DGARRLGEVALVPHSSPISASGILFYN
  401 IQVRFEGGRIVEA--KAS-RGEEVLKKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  402 IQVRFEAGRIVEA--KAS-RGEEVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  403 IQVRFEAGRIVEA--KAT-KGEEVLLKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  404 IQVKFEAGRIVEA--KAS-KGEAVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  405 IQVKFEAGRIVEA--KAS-KGEAVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  406 IQVKFEGGRIVEA--KAS-KGEAVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  407 IQVKFEGGRIVEA--KAS-KGEAVLNKVLDTD-EGARRLGEVALVPHSSPISASGILFYN
  408 IAVRFEGGRIIEA--RAS-RGEEVLNKVLDTD-EGARHLGEVALVPHSSPISQSGLLFYN
  409 IAVRFEGGRIVEA--KAS-RGEEVLNKVLDTD-EGARHLGEVALVPHSSPISQSGLLFYN
  410 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  411 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  412 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  413 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  414 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  415 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  416 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  417 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  418 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  419 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  420 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  421 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  422 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  423 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  424 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGACRLGEVALVPHSSPISQSGLLFYN
  425 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  426 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  427 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  428 IAVRFEGGRIVEA--RAS-RGEEVLSKVLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  429 IRVRFEGGRIVEA--HAA-TGEEVLQKVLDID-EGARRLGEVALVPHSSPISASGVLFYN
  430 IEMVFKDGVAVEV--RAS-KGENVWNKVLDTD-EGGRRLGEVALVPHSSPISQSGVLFYN
  431 IEVRFEAGRIVNA--SAS-KGQEVLQKVLQSD-EGASRLGEVALVPHSSPISKSGLLFYN
  432 IEVRFEAGRIVNA--SAS-KGQEVLQKVLQSD-EGASRLGEVALVPHSSPISKSGLLFYN
  433 IEVRFEAGRIVSA--SAS-KGQEVLQKVLQSD-EGASRLGEVALVPHSSPISKSGLLFYN
  434 IEVRFEEGRIINA--SAS-KGQEVLQRVLQSD-EGASRLGEVALVPHSSPISKSGLLFYN
  435 IEVRFEAGRIVDA--RAS-LGQQVLQQVLQSD-EGASRLGEVALVPHSSPISKSGLLFYN
  436 IEVRFEAGRIVES--RAS-TGQEVLQQVLQSD-EGASRLGEVALVPHSSPISKSDLLFYN
  437 IEVRFEAGRIVEA--RAS-TGEAVFQQVLQSD-EGASRLGEVALVPHSSPISKSDLLFYN
  438 IEVRFEAGCIVDA--RAS-TGREVLQQVLQID-EGASRLGEVALVPHCSPISKSNLLFYN
  439 IEVRFEAGRIVEA--RAS-KGQEVLQQVLQSD-EGASRLGEVALVPHSSPISKSDLLFYN
  440 IEVTFKDGRIIEA--KAE-KGGDILRELIATD-EGAARLGEVALVPHSSPISQSGLLFYN
  441 IEVTFKDGRIIEA--KAE-KGGDILRELIATD-EGAARLGEVALVPHSSPISQSGLLFYN
  442 IEVTFSDGRITDA--RAD-KGQDILRELIATD-EGAAHLGEVALVPHGSPISQSGLLFYN
  443 IEVRFEGGRITEA--RAT-RGEAVLHKLLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  444 IRVRFEGGQVVEA--HAS-TGQEVLQKMIGTD-EGARRLGEVALVPHSSPIAQSGLLFFN
  445 IRVRFEGGRIVEA--QAS-AGDAVLQKMISTD-EGARRLGEVALVPHSSPISQSGLLFFN
  446 IAVRFEAGRIVEA--TAS-KGEDVLNALLKTD-DGASRIGEVALVPHSSPISQSETLFYN
  447 IKVRFEAGRIVEA--TAT-KGEAVLQALLNTD-DGACRIGEVALVPHSSPISQSGTLFYN
  448 IAVRFEDGRITEA--HAR-TGQDVLERILDTD-DGARRLGEVALVPASSPISRSGILFRN
  449 IAVRFEDGRIVEA--HAR-TGQDVLERILDTD-DGARRLGEVALVPASSPISQSGILFRN
  450 IAVRFEDGRIVEA--RAS-QGQAVLERILDTD-DGARRLGEVALVPASSPISESGILFRN
  451 IAVRFEEGRIVEA--RAS-SGQAVLERILDTD-EGARRLGEVALVPASSPISESGILFRN
  452 IAVRFQDGRIVEA--SAR-TGQEVLTRILDTD-EGARRLGEVALVPASSPISSSGILFRN
  453 IAVRFADGRIVEA--HAT-EGLEVLERILDTD-EGARRLGEVALVPHSSPISQSGVLFRN
  454 ISVRFENGKIVEA--SAS-HGEDVLKRILSTD-EGAARIGEVALVPHSSPISASKILYRN
  455 ISVRFEAGRIVEA--HAS-QGEDVLNRILDTD-EGARRIGEVALVPHSSPISASGILYRN
  456 IRVRFEAGRIVEM--HAS-KGEDVLARVLDTD-EGARRLGEVALVPNSSPISRSGILFQN
  457 IRVRFEAGRIVEM--HAS-KGEDVLARVLDTD-EGARRLGEVALVPNSSPISRSGILFQN
  458 IRVRFEAGRIVEM--HAS-KGEDVLARVLDTD-EGARRLGEVALVPNSSPISRSGILFQN
  459 IKVRFEGGKIVEM--NAA-KGEDVLARVLDTD-EGARRLGEVALVPHSSPISRSGILFQN
  460 ISVVFKDGVIIEA--KAS-KGEEVFLKLLDTD-EGARRLGEVALVPHGSPISQSNLLFYN
  461 ISVRFENGRIVEA--HAA-AGEAVLQRMIETD-AGARMLGEVALVPHSSPISASGVLFWN
  462 IHVRFEGGRIVEA--RAS-RGQEVLQKLIDTD-DGARRLGEVALVPHSSPIASSGILFYN
  463 IMCRFEKGRIVEA--TAS-AGEDALNRLISTD-EGARSLGEVALVPHSSPIAQSGILFYN
  464 IQCTFENGRIVEA--NAS-AGQDALRKLIAVD-EGAARLGEVALVPHSSPIAQSGLLFWN
  465 IRCTFKDGKIVEA--TAT-KGQEAINKLISTD-DGARRLGEVALVPHNSPIAQSGILFWN
  466 IRVRFDQGRVVEA--SAS-KGEDMLNRILDID-EGARRLGEVALVPNTSLLSKMNTLFYD
  467 IRVRFDQGRVVEA--SAS-KGEEMLNKILDID-EGARRLGEVALVPHSSLLSKMNTLFYD
  468 IRVRFDQGRVVEA--SAS-KGEEMLNKILDID-EGARRLGEVALVPHSSLLSKMNTLFYD
  469 LRMRFEQGQVVEA--HAE-RGQEILHHLLQTD-EGARRLGEVALVPHSSPIAQSGLLFYE
  470 IRIEFQGGRVTSA--SAK-QGEDTLKQMIDTD-EGSHRLGEVALVPHSSPISRSGLFFFN
  471 IRIEFKDGRITGA--SAR-TGEAALQKMIATD-EGSHRLGEVALVPHSSPISRSGLFFYN
  472 IRIRFEGGRVVEA--TAQ-QGQDTLAQLIDTD-EGSHRLGEVALVPHSSPISRSGLFFFN
  473 IRIEFKDGRITGA--SAK-QGEAALLKMIDTD-EGSHRLGEVALVPHSSPISRSGLFFYN
  474 IRIRFEGGRIVEA--TAT-QGEATLKRMIETD-EGSHRLGEVALVPNSSPISTSGLFFYN
  475 IRMRFEGGKAVEV--TAE-QGEETLRELVATD-DGAARLGEVALVPHSSPISQSGLFFFH
  476 FSLTFEAGRVVSA--KAA-RGQEALDRLLDTD-EGARRLGEVALVPHSSPISQSGLLFYN
  477 IRVRFEGGRAVEV--TAE-RGEETLKQLVGTD-EGAAHLGEIALVPASAPVARTGTLFLN
  478 IRVRFEGGRAVEV--TAQ-QGEETLRKLIDTD-EGAAHLGELALVKASAPVAQTGTLFLN
  479 IRVRFEGGKAVEV--RAE-QGEETLRQLLATD-EGAAHLGEIALVPASAPVAQTGTLFLN
  480 IRVRFENGKAVEV--SAE-KGEDTLKSLIATD-EGAAHLGEIALVAASAPVAQTGTLFFN
  481 IRMRFEGGRAVEA--TAE-TGQDTLQQLLATD-EGAARLGEVALVPASAPVAQTGSLFNM
  482 IRVRFEGGRVVEA--TSD-TGQDVLTALLDTD-EGARHLGEVALVPASAPVARTGHLYYD
  483 LRVTFAGGRAVEL--EAA-RGLEAVRAVLETD-AAARRLGEVALVETPNPVFDTGRLFLN
  484 LVVTFRNGVAEHV--EAR-EGREMLEGLLSGD-KGARRLGEVGLVPCNSPVARKEVLFYN
  485 FTLTFKDGEITDF--FAE-KGMDALQSILQKD-EGARYIGEVALVPHDSAISASNLLFYH
  486 AWFRFEDGEVVEF--KAG-VGQDVLAQFFEI--EGARRLGEVALVDASSPIFQSGLLFHE
  487 FWFEFKNGQVVDY--DAK-VGKEVLTSILETD-EGSKYLGEIALVPYGSPISAMDTLFYE
  488 IEVEFAGGEVVRV--DAT-TGADVLRGWIERD-AGARRLGELALVDGDGRVGRTGTVFHE
  489 LELEFRDGRAVRV--DAE-RGAELVRAQVARD-EGAARLGEVALVDGDGRVGALETVFLE
  490 IWLEFREGKVINFGCDDD-QSRNILKRHIETD-IQAQYIGEVALVDNSSPIYQSGLTFYS
  491 IWLEFREGKVINFGCDNE-QSRNILKRHMETD-MQAQYIGEVALVDCNSPIYQSGLTFCN
  492 IWMEFQEGKIINFGCDND-TLNDILKRHIETD-VQAQYIGEVALVDNSSPIYKSGLTFYN
  493 IWMEFQEGKIINFGCDND-TLNDILKRHIETD-VQAQYIGEVALVDNSSPIYKSGLTFYN
  494 IWMEFQEGKIINFGCDND-TLNDILKRHIETD-VQAQYIGEVALVDNSSPIYKSGLTFYN
  495 IWLKFENGKVVDFGCNDE-KQKEILKSHIETD-IQAKYIGEVALVDSSSPIYQSNLIFYS
  496 IWLKFENGKVVDFGCNDE-KQKEILKSHIETD-IQAKYIGEVALVDSSSPIYQSNLIFYS
  497 MWLKFENGKVVDFGCSDE-KQKEILKSHIETD-IQAKYIGEVALVDSSSPIYKSNLIFYS
  498 MWLKFENGKVVDFGCDDE-KQKEILKSHIETD-IQAKYIGEVALVDSSSPIYQSNLIFYS
  499 MWLKFENGKVVDFGCDDE-KQKEILKSHIETD-IQAKYIGEVALVDSSSPIYQSNLIFYS
  500 IWLKFENGKVVDFGCNSE-KEKEILKSHIESD-IQAKYIGEVALVDSSSPIYQSNLIFYS
  501 IWLKFENGKVADFGCDDE-KQKEILKSHIETD-IQAKYIGEVALVDSSSPIYQSNLIFYS
  502 ARFTFRDGRVVEH--DAA-EGKEALDRYLDID-AGARSIGELALVDSSSPIYQSGLLFNS
  503 IRLEFKDGKVVDY--SAK-VGKDVMDAFFSID-EGTRRIGECALVDETNPIAKSKLVFDS
  504 VRFVFEEGKVVDY--SAK-EGKEALDSFFSID-EGTRRLGEVALVDETSPIAQSNLIFNS
  505 VRFVFKNGRVVDF--NAR-KGAEVIRKHLEVD-EGSSRLGECALVDESNPIAASGLIFHS
  506 FTLCFEHGKLIQY--NAM-KNQELLEEIVHAD-ENNSYCGEIAILPGTTEISKTNTVFHT
  507 FSLHFEKGKILDY--CAT-DNKSILDEIINLD-ENNRYPGEIAILPGETEISKTNIIFQT
  508 VKLVFRKGEVVEA--TAR-RGEAFLKKMLETD-DGARKVGEIAF--GLNY--NITRFTKE
  509 VKLVFRKGEVVEA--TAR-RGEAFLKKMLETD-EGARKVGEIAF--GLNY--NITRFTKE
  510 VRLVFRRGEVVEA--SAR-RGEQFLRKMLETD-EGARRVGEIAF--GLNY--NITRFTKE
  511 VKIVFKKGVVVEA--HAR-RGEEFLKKMLETD-EGAKRLGEIAF--GLNY--NITRFTKE
  512 VKLVFKKGVVVEA--HAR-RGEEFLKKMLETD-EGAKRLGEIAF--GLNY--NITRFTKE
  513 VRLVFKNGRVVEA--SAT-RGEEFLKKMLNTD-EGASRLGEIAF--GLNY--NINRHTKE
  514 VRLVFRRGEVVEA--TAR-RGEDFLRKMLQTD-EGARRLGELAF--GLNY--NIDRFTKE
  515 VKLKFKSGTIIEA--NAS-KGEDFLKKMISTD-EGSKRVGEFAF--GLNY--DITRFTKE
  516 VRLKFEKGVVVEA--SAI-KGEEFLRKMLQVD-EGAKRVGELAF--GLNY--DITRFTKE
  517 VRLEFRGGQVVKA--SAS-KGEEHLRRILETD-EGAKRLGELAF--GLNY--DIQRHIKN
  518 ITLWVKAGEIQRW--EAK-KGQKLLDQIFEI--PGARRFGEAAI--GTNR--DIQRPVKN
  519 IRLEFKAGKVVQA--SAA-KGEKLLNSLLETD-EGARYVGEVAV--GCNK--GINKFSRN
  520 IRLIFKEGKVVEA--SAS-KGEDLLHSLLDTD-KGSRFVGEVAI--GCNT--GIKKFTRN
  521 VHLTFKNGRVIKA--EAE-KGEDFLNKMLDTD-EGARAAGEIAF--GLNN--AIKKATGN
  522 IELHFEKGKVVKA--TAK-KGEEFLNRMLESD-EGAKYVGEIAF--GLND--DIVKPSKN
  523 ITLKIDKGRIIEA--SAE-KGDDFLQSVLDTD-EGSRLIGEIAF--GLND--NINKPTKN
  524 ITLKIEKGRIMEA--HAE-KGDDFLQSVLETD-EGSRFIGEIAF--GLNE--SITKPTKN
  525 IRLWFEKGKVVKA--TAE-TNEEFLLKTLDTD-PGARYLGEFAI--GTSE--GIQKFTKQ
  526 IRLWFKKGKVVKA--TAE-TNEEFLLKTLDTD-SGARYLGEFAI--GTSE--GIQKFTKQ
  527 IRLWFKKGKVVKA--TAE-TNEDFLLKTLDTD-PGARYLGEFAI--GTSE--GIQKFTKQ
  528 IRLWFKKGKVVKA--TAE-TNEDFLLKTLDTD-PGARYLGEFAI--GTSE--GIQKFTKQ
  529 IRLWFKKGKVVKA--TAE-TNEDFLLKTLDTD-PGARYLGEFAI--GTSE--GIQKFTKQ
  530 VRLWFENGNVVKA--TAE-KNEEFLLRTLDTD-EGARRLGEFAI--GTNE--GITRFTGE
  531 VELTFEKGQVVKA--SAR-TNTEFLEQTLNSD-PGARYLGEFAI--GTNF--HINRFTGN
  532 AELTFSNGRVTQA--RAE-KNQDFLLRMLETD-GGARYLGEFAI--GTNF--EIDRFTGQ
  533 IRLVFKDGKVVEA--TAR-EGQDILENMLSMD-EGARYLGEFAF--GNNP--RVTRGTRN
  534 VQLTFEAGKVVKA--TAK-SGQDFLEQMLNVD-AGARILGEFAF--GTNP--NIKNYTRN
  535 IRLRFEDGRVVQA--EAA-RGQALLDALLATD-QGARYVGEFAI--GTNE--RITRFSRN
  536 IRLRFEDGRVVEA--RAA-RGQDLLEALLGTD-EGARYVGEFAI--GTND--QITRFSRN
  537 IRLWFEDGKVVKA--TAA-KGEDLLHSLLAMD-EGARRLGEVAF--GTNY--DITRFSRN
  538 IRLWFENGRVVKA--TAA-KGEDLLHSLLNMD-EGARRLGEVAF--GTNY--DITRFSRN
  539 IRLWFEGGRVVKA--TAA-RNEAFLHRMLETD-EGARLVGEFAF--GLNR--SITRFTGN
  540 IRLWFEGGRVVKA--TAA-RNEEFLHAMLETD-EGARYVGEFAF--GLNR--AITRFTGN
  541 VRLWFERGRVVKA--TAA-KNQDFLEAMLNTD-EGARYLGEFAF--GTNR--AIDRFTRN
  542 VRLTFQDGKVVEA--TAS-RGEDLLNSMLNVD-EGARRVGEVAF--GLNY--DIQKFTRN
  543 VYLRFQQGQVVEA--RAE-RGEEYLHSMLETD-PGAKFLGELGI--GTNF--GIDRPTGI
  544 IYLRFEGGEVVEA--RAR-QGEAYLLRMLEAD-AGARRLGEFGI--GTNF--GIDRPTGI
  545 VYLRFARGQVVEA--RAE-VGEAYLQAALATD-EGARRLGEVGI--GTNF--ALDRPTGL
  546 VYLRFHRGEVVEA--RAR-VGEDYLKEALATD-PGARRLGEVGI--GTNF--ALDRPTGL
  547 VYLRFKGGEVVEA--RAE-VGEEYLLAALATG-EGARRLGEVGI--GTNF--GLTRPTGL
  548 VRLVFRAGRVVEA--SAQ-TGEEYLLKMLEAD-PGARCLGEVGI--GTNF--GITHPTGL
  549 VELTFRDGEVASA--RAG-RGQAYLDRTLATD-PGARRLGEIGI--GTNF--GITRPIGA
  550 VRLVFEAGRVVEA--SAE-EGDAYLQAMLATD-AGARGVGELGI--GTNS--GLERGTGL
  551 ARLVFRAGEVVEA--SAE-EGEDVLRAALATD-PGARRLGELGI--GTND--GIQTPTGN
  552 ARLVFRAGEVIEA--SAE-EGEDVLRAALATD-AGARRLGELGI--GTNS--GIQIPTGN
  553 ARLVFRAGQVVEA--SAE-EGEAVLHAALDTD-PGARRLGELGI--GTNF--GIQRGIGN
  554 ARLEFRDGVVVSA--RAD-EGEDVLLAALDTD-PGARRLGEIGI--GSNF--GIQRPTGN
  555 IRLEFRDGKVVDA--TAE-EGEAALLAALDTD-EGARFLGELGI--GTNF--GIQVPTQN
  556 VRLQFREGRVVHA--TAE-KGEDLLKAQLGTD-EGARYLGELGI--GTNS--RIQRPIKS
  557 VRLRFENGRVVEA--SAE-KGEEYLRSMLDAD-EGARYLGELGI--GTNY--HIPRPTRN
  558 IELEFRDGVVVHA--RAQ-AEEAYLLSMLDLD-PGARRLGEFGI--GLNS--GIDRFTGS
  559 IALEFAEGRVVSA--RAD-EGEDYLLSMLDLD-AGSRRLGELGL--GLNP--GIDRFTGS
  560 IQLVIEDGKVTQA--TAE-QGQDFLHTMLDLD-AGARYIGEVAF--GLNP--GITKPTGH
  561 IELKFEKGAVVEA--NAS-KGQEFLREMIAQD-AGAKFVGEIAI--GTNY--QMTTVTKN
  562 VFLRFEDGEVVEH--SAA-KNEDLLTEVLSTD-DGASRLGELGI--GMNR--DIDQFSYN
  563 VFLRFEDGEVVEH--SAG-KNEDLLTEVLSTD-DGASRLGELGI--GMNR--DIDQFSYN
  564 AYLTFEDGEVVDH--SAS-KNEDVLTEVLDTD-AGARRLGELGI--GMNR--DIDQFTYN
  565 VYLEFEGGEVVDH--SAA-KNEDVLTEVLNTD-DGARRLGELGI--GMNR--EIDRFTYN
  566 VYLEFEGGEVVDH--SAA-KNEDVLTEVLNTD-DGARRLGELGI--GMNR--DIDQFTYN
  567 VYLEFEGGEVVSH--SAA-KNEEILTEVLNTD-DGARRLGELGI--GMNR--DIDRFTYN
  568 VALEFAGGEVVSH--SAG-QNEDLLTEVLSTD-EGARRLGELGI--GMNR--DIDRFTYN
  569 AHLVFEDGEVVEH--SAD-QNEGLLTEVLNTD-PGASRLGELGI--GMNR--DIDEFTYN
  570 ARLVFEDGEVVEH--SAS-KNEDLLTSILDTD-EGARRLGELGI--GMNR--DIDRFTYN
  571 ARLVFEDGEVVEH--SAS-KNEELLTSILDTD-EGARRLGELGI--GMNR--DIDRFTYN
  572 VWLEFEDGEVVDF--SAE-KNEEVLAGVLDTD-EGARRLGELGI--GMNR--DIDRFTYN
  573 VRVRFEDGRVESY--SAE-RNEEVLDGVFETD-EGARYLGELGI--GMNR--AIDQFTYN
  574 VRVQFNEGYVESY--SAG-RNETVLDGIFATD-EGARYLGELGI--GMNR--AIDQFSYN
  575 VRVRFEDGEVVDY--SAE-GNEEVLDGVFDTD-EGARYLGELGI--GMNR--GIDQFTYN
  576 VRLRFEDGEVVSH--SAE-RNEDLLTGILDTD-EGSRHLGELGI--GMNR--QIDRFTYN
  577 ARVTFENGRVTEF--SAG-RNEDVLTGVFETD-EAARYLGELGI--GMND--AIDRFTSN
  578 AALTFEDGEVVSF--SAE-QNEDVLAAILDTD-DGARRLGELGI--GMNR--DIDRFTYN
  579 AWLKFENGEVVDF--SAE-QNEGVLEGILTTD-EGSNRLGELGI--GMNR--DIDRFTYN
  580 VRLRFEGGEVVES--AAE-RNEEALDDLLDTD-DGARRLGELGI--GTNR--EIDRFTKN
  581 VHLVFEDGEVVDY--SAT-AGEETLAALLDTD-DGARRLGELGV--GMNR--GIDRYTDN
  582 VHLVFEDGDVVEH--AAA-AGEETLAALLETD-AGARRLGELGV--GMNR--GIDRYTDN
  583 VRLVFEDGEVVDY--SAA-QGESTIGELLATD-AGARRLGELGI--GMNR--GIDRITDN
  584 VELTFKDGVVVDW--SAE-QGEAVIDEIIGTD-SGSRQLGELGI--GMNR--GVDRVTDN
  585 VELTFKDGVVVDW--AAE-QGEGVIGEIIGTD-GGSRQLGELGI--GMNR--GVDRVTDN
  586 VHLTFEDGEVVDY--AAA-QNEGVVGEILETD-AGAKRLGELGI--GMNR--GIDQFTDS
  587 VHLTFEDGEVVDY--SAA-ENESVVGDILDTD-AGARRLGELGI--GMNR--GIDQFTDS
  588 VRLEFEDGEVVDY--DAA-QGADVIGEIIATD-DGARRLGELGI--GMNR--GIDRYTDN
  589 VRLEFADGAVVDY--DAE-QGGDVIGDVLETD-DGARRLGELGI--GMNR--GIDRYTDN
  590 VRLEFDDGEVVDY--GAE-QGEEVISEILETD-DGARRLGELGI--GMNR--GIDQYTDN
  591 VRLEFEDGEVVDY--DAD-QGEAVIGDILDAD-EGARRLGELGI--GMNR--GIDRYTDN
  592 VRLEFEDGEVVDH--EAD-QGESVVGEILDAD-EGAHRLGELGI--GMNR--AIDRHTDN
  593 VHLTFADGEVTDF--TAE-SGEDALAEIFDTD-DGARRLGELGI--GMNR--GIDRFTDN
  594 VHLTFEGGEVVDF--SAG-AGEDALAGILDTD-EGARRLGELGI--GMNR--GIDRFTDS
  595 VHLTFEGGEVVDF--SAE-TGEDELADILDTD-EGARKLGELGI--GMNR--GIDRFTDS
  596 AELTFEDGTVVDY--DAT-AGVETLAQILNTD-PGARRLGEVGI--GMNR--GIDQITNK
  597 ITLRWKMGELVQA--TAS-KNEEFLKAVLSTD-PGASRIGEFAI--GTNP--GLKHMCGD
  598 IYLRWGKGKLVEA--HAS-THEDFLHAVLSSD-PGASRIGEFGI--GINP--YISFFSKD
  599 LEFEFEGGRIVSE--RAA-AGVDFVRELLDAD-DGARRLGELGI--GTNA--ALTLMTGD
  600 ARLEFVDGKIVHA--TAN--DTERLNKILDTD-EGARYIGEFAL--GVNP--FIREPMQD
  601 IRLEFKDGKIVKA--TSN--ETEKLNKILDTD-EGARYIGEFSL--GLNP--HIQHPMLD
  602 ISFTFENGKIVNA--TSN--DTKKLNEILDSD-EGARYVGEFAI--GFNP--YILHPMND
  603 IKFRFENGKIVEA--TGS--DTKRLNEILDSD-EGARYIGEFAI--GFNP--YILTPMKD
  604 VTFRFEKGRIVEA--TAN--DTKRLNQILDTD-EGARYIGEFSL--GFNP--HILYPMKD
  605 VVLRFENGKIVEA--TSS--NTPRLNEILDTD-EGARFIGEFAI--GVNP--HIHHPMKD
  606 VQFTFKEGKIVEA--TSS--NTKALNDILDTD-EGARYIGEFAI--GFNP--HILHPMLD
  607 IRLEFKDGKIVQA--TAN--DTEKINKVFDTD-KGARYVGEFAL--GVNP--YITKPMKD
  608 IRLEFKNGKIVQA--TAN--DTERINKVFDTD-EGARYVGEFAL--GVNP--FITKPMKD
  609 ICLEFKDGKIIKA--TAN--DTERINKILDTD-EGARYVGEFAL--GVNP--YITRPMKD
  610 IRLEFKDGKIVDA--TAN--DTERINEIFDTD-EAARYVGEFAI--GVNP--YIETPMKD
  611 IRFEFQEGKIVRA--TAN--DTEKINKVLDTD-EGARYIGEFAL--GVNP--YIEKPMKD
  612 IRFEFKDGKIIKA--TAN--DTERLNKILDTD-EGARYIGEFAI--GINP--HILKPMKD
  613 ISLTFENGKIIQA--AAN--NTEKINKILDTD-QGARFIGEFAL--GVNP--FVLKPMKD
  614 IVLNFEKGKIVKA--TAN--DTERIESVFNTD-EGARFIGEFAI--GVNP--FISTPMKD
  615 IVLEFKDGQIVKA--TAN--DTQRIEEIFNTD-EGARYIGEFAI--GVNP--YILHPMKD
  616 IRFVFKNGKIVNA--ICN--DTERINEILDTD-EGARYIGEFAI--GVNP--YILTPMKD
  617 IKLTFKDGKIVEA--TAN--DTEKINEIFDTD-EGARFVGEFAI--GVNP--YIQNPMKD
  618 VRLTFKDGKIVEA--TAN--DTERLNQILDTD-EGARFIGEFAI--GVNP--YIRNPMKD
  619 VSFTFKDGKIIEA--TAN--DTERINRILDSD-EGARYIGEFAI--GVNP--YILHPMKD
  620 IKFTFENGKIVKA--EAN--DTDRINRILDTD-EGARYIGEFAI--GVNP--YIQHPMKD
  621 VKLTFKDGKIVEA--SAN--DTDRINKIFDTD-EGARYIGEFAI--GVNP--YILHPMQD
  622 VKLTFKDGKIIEA--TAN--DTERINQIFDTD-EGARYIGEFAI--GVNP--YIQHPMQD
  623 VSLTFKNGKIVEA--TAN--DTERINGIFDTD-EGARFVGEFAI--GVNP--YIQHPMQD
  624 VKLTFENGKIVDA--EAN--DTKRINKIFDTD-EGARYIGEFAI--GVNP--YILHPMQD
  625 VQLKFENGQIVEA--TAN--DSERINKIFDTD-EGARYVGEFAI--GVNP--YILHPMGD
  626 VQLKFENGQIVDA--TAN--DSERINKIFDTD-EGARYVGEFAI--GVNP--YILHPMGD
  627 VQLKFENGQIVEA--TAN--DTERINKIFDID-EGARYVGEFAI--GVNP--YILHPMGD
  628 VQLKFENGQIVEA--TAN--DTERINKIFDTD-EGARYVGEFAI--GVNP--YILHPMGD
  629 VQLKFKDGKIIEA--TAN--DTDRINKIFDTD-EGARYVGEFAI--GVNP--YILHPMGD
  630 VSFTFKDGKIVEA--TAN--DTERINKVLDTD-EGARYVGEFAI--GVNP--FIHEPMQD
  631 VSFTFKDGKIVEA--TAN--DTDRINKVLDTD-EGARFVGEFAI--GVNP--FIHEPMQD
  632 VSFTFKDGKIIKA--TAN--DTDRINKVLDTD-EGARFVGEFAI--GVNP--FIHEPMQD
  633 VSFTFKDGKIVKA--TAN--DTDRLNKVLDTD-EGARFVGEFAI--GVNP--FIHEPMQD
  634 VSFTFKDGKIIEA--TAN--DTARINKVLDTD-EGARFVGEFAI--GVNP--FIHEPMQD
  635 VTLTFKDGKIVEA--TAN--DTERINQVFDTD-AGARFVGEFAI--GVNP--FIQHPMKD
  636 VKLTFKDGKIVDA--TAN--DTERINEVFNTD-EGARYVGEFAI--GVNP--YIQHPMKD
  637 IRFTFENGKIIAA--SSS--DDKKINEILDTD-EGARYIGEFAI--GVNP--YILHPMQD
  638 IRFTFENGKIVNA--TSN--NNEKINAILDTD-EGARYIGEFAI--GVNP--YISHPMQD
  639 ICLEFKDGKIIKA--TAN--DTERINKVFDID-EGARYVGEFAI--GVNP--YVLNPMKD
  640 IRFEFKDGKIVKA--TAN--NTEKLNKILDTD-EGARYIGEFSI--GLNP--YITKPMED
  641 IRFEFKDGKIVKA--TAN--NTEKLNKILDTD-EGARYIGEFSI--GLNP--YITKPMED
  642 IRFEFKDGKIVKA--TAN--NTEKLNKILDTD-EGARYIGEFSI--GLNP--YITKPMED
  643 IRFEFKDGKIVKA--IAN--NTEKLNKILDTD-EGARYIGEFSI--GLNP--YITKPMED
  644 IRFEFKDGKIVKA--TAN--NTEKLNNILDTD-EGARYIGEFSI--GLNP--YITKPMED
  645 IRFEFKDGKIVKA--TAN--NTEKLNKILDTD-EGARYIGEFSF--GLNP--YITKPMED
  646 IRFEFKDGKIVKA--TAN--NTEKLNKILDTD-EGARYIGEFSI--GLNP--YITKPMED
  647 VRFVVKDGRIVEA--TAN--NTEKLNKILDTD-AGARYFGEFAI--GVNP--YITKPMKD
  648 IKFEFKNGKIINA--TCN--DTNRINKILDSD-AGSRYIGEFAI--GVNP--YITEPMKD
  649 VRFEFKNGKIVNA--SCN--DTKRINKILDTD-SGSRYIGEFAI--GVNP--YITEPMKD
  650 ISFRFENGKIVEA--SAN--DSKRLNAVLDTD-EGARYVGEFSF--GLNP--YILEPMKE
  651 IKLTFKDGKIVEA--TSN--NNERINKVFDMD-EGARYVGEFAI--GINP--FINEPMLD
  652 IRLVFKQGKIVEA--TCETGDNKSLNAIFDTD-EGARYVGEFAI--GFNP--FVLSPMCD
  653 IHLKFEKGKVVHA--EGS--NTQRLNEILDSD-AGARYIGEFAI--GFNP--HILEPMRD
  654 IRLVFKRGKIVEA--TSS--NTKRLNEILDSD-SGARYIGEFAL--GFNP--HILQPMRD
  655 IRLEFKKGRIVEA--TAN--NTARLNEILDSD-EGARRIGEFAI--GFNP--HIKEPMRD
  656 VRLEFKDGKVINA--TAN--HTEKLNAILDSD-AGARYIGEFAI--GFNP--HVLHPMRD
  657 VHLEFKDGKIIKA--TAN--NTKRLNEILDTD-AGARYIGEFSL--GFNP--YIQNPMCD
  658 IQFTFEHGKIVDA--RCD-GETERLNKILDTD-EGARYIGEFSV--GVNY--EIQQPILD
  659 VRFTFREGKIVEV--YAN--HTDKLIEILDTD-EGARYIGEFAI--AFNP--YILHPMGD
  660 VCLKFVDGKIVEA--TSN--NTKRLNEIFDTD-EGARFIGEFAI--GVHP--YILHPMND
  661 ISFRFEKGRIIEA--KAN--DSERINQVLDTD-DGARYIGEFSF--GCNP--WIESPMDN
  662 VRFTFKDGKIVEA--HAD--DDVLLTKILDSD-EGARYVGEFAL--GVNP--QVTEPMDN
  663 IRLTLKNGLVVHA--EAG-DKTGELNAILDTD-PGARRLGEFAF--GVNP--AITRPMRN
  664 IRLVFKRGRIVEA--DCRVGDSHRLRAILHSD-EGACRIGEFAI--GCNP--RILQPMRD
  665 IQLTFENGKVTNC--QSD--NNQKLNDLLDSD-EGARYIGEFAI--GVNP--YINHIMND
  666 VRFEFSRGRIVAA--SAAGGMSDALNKILDTD-DGARYIGEFAL--GINP--GIRTPMRN
  667 IRLEFKDGRIIKA--TAG-EMTKALNEILDTD-EGARYVGEFAV--GVNP--NIRTPMRN
  668 VRLEFKKGKIVKA--SAP-GMDDALNSILDTD-EGARYVGEFAV--GVNP--NIRVPMRN
  669 IRLEFSKGQIVKA--TSR-GMDKELNGVLDTD-EGARYVGEFAI--GVNP--NIRVPMRN
  670 VRLEFAKGRIVKA--SAP-GMDDELNRILDTD-EGARFIGEFAI--GVNP--NIRVPMRN
  671 IRLEFENGRIVRA--NSP-GMDEELNRILDTD-DGARYVGEFAI--GVNP--KITVPMRN
  672 IRLEFENGRIVRA--NSP-GMDEELNRILDTD-EGARYVGEFAI--GVNP--KITVPMRN
  673 LTMEFKNGELVKY--EAK-AGLDAFKRAVEMD-EGARFVGELGI--GTNP--HLKQHVAN
  674 VRLEFKDGEVVDV--QAE-EGEAFTKDQLDMD-VGARRLGEFSL--TDTRFSRIDKFMAH
  675 VRLEFKDGRLQEI--SAE-EGEEFLKKQVRMD-EGASMVGEFSL--TDKRFSRISSFMAH
  676 VRLTFKDGVVTDI--AAE-QGEEFVRKQLAMD-PGASRLGEFSL--TDKRFSMIDRFMAN
  677 VRLTFKDGVVTDI--AAE-QGEEFVRKQLAMD-PGASRLGEFSL--TDKRFSKIDRFMAN
  678 VRLTFEEGVVTDI--AAD-QGAEFVRKQLSMD-PGASRLGEFSL--TDKRFSKIDKFMAN
  679 VRLTFKDGQVAEV--SAE-QGEQFVRKQLAMD-PGASRIGEFSL--TDRRFSRIDKFMAN
  680 VRLTFEKGIAVKT--EAK-VGGEFVAKQLTLD-EGANRLGEFSL--TDRRFSKITAFMAN
  681 VRLTFEKGVAVKT--EAK-TGGDFVAKQLTLD-EGANRLGEFSL--TDRRFSKINAFMAN
  682 VRLVFEDGIATEI--SAK-EGEEFVKKQLAMD-EGAARLGEFSL--TDRRFSRIDKFMAN
  683 VTLEFSAGQARVV--KAD-QGEEFVRSQLEMD-PGACRLGEFSL--TDKRFSPINAFMAH
  684 VKLTFKAGVVTDV--QAE-QGQEFTIQQLNMD-QGARRLGEFSL--TDRRFSRIDRFMAH
  685 VRLEFKKGEAVKI--EAE-TGEEFVKNQLAMD-KGANKIGEFSL--TDKRFSKIKKFMAN
  686 MRVEFKDGKAVKV--TAR-AGQAFARKYLSTD-PGAARLGEFSL--TDKRFSRIDKFMAN
  687 VCLEFSKGKVVKV--TAK-QGEDFVKKQVAMD-KGAGRLGEFSL--TDRTFSKIDKFMAN
  688 VRLRFEKGVAVST--EAQ-KGQDFVVKQLAMD-KGAAQVGEFSL--TDRRFSRIDRFMAD
  689 VRLEFRQGRVVRL--DAE-QGEGFATGQLNSD-PGAAMLGEFAL--VDRRFSRITRFMAN
  690 VRLEFRQGRVVRL--DAE-QGEGFATGQLNSD-PGAAMLGEFAL--VDRRFSRITRFMAN
  691 IRLTFRKGVVTAL--AAE-KGEAFAAGQTSID-AGAARVGEFAL--VDKRFSPIGRFMAN
  692 IRLEFKGGRVTSL--TAE-EGHSFAVEQVNSD-PGAALLGEYAL--VDRRFSRIGRFMAN
  693 AYLEFKDGRVVKA--TAS-KGEELLKEMVAVE--NADKVGEFSL--TDRRFSRITKFMGE
  694 IEIIVKDGFAEDI--RGG-EEAEKLREILSRYGKEARNIAEFGV--GTNP---KARISGN
  695 LTIEVVASRLRSARSSNK-ELEQEFWRYCHTD-ENSDRVGEFAI--GTNI--AVRDVIGN

         34             35            36         37        38     
      678901ABCDE234567890123A45678ABC90A123456789012345678901ABCD
                    #      #                            # #       
                                                                  
    1 TLFDEN-----ASCHLALGECYP-TTVQD-GEKM-NEEELHQIGGNHSINHVDFMI----
    2 TLFDEN-----ASCHLALGECYP-TTVQD-GEKM-NEEELHQIGGNHSINHVDFMI----
    3 TLFDEN-----ASCHFALGECYP-TNIKD-GGKM-TKAELIAAGGNQSDTHVDFMI----
    4 TLFDEN-----ASCHFALGAAYP-TCIEG-GQNM-SETELAAAGLNISTTHVDFMV----
    5 TLFDEN-----ASCHFALGAAYP-TCVKD-GSSM-SVDELKEAGLNYSTTHVDFMV----
    6 TLFDEN-----ASCHLALGKAYP-VCMKN-SEKL-TPEDFTTLEINESLVHVDFMI----
    7 TLFDEN-----ASCHLAIGKAYP-VCMKN-SEKI-PPEEYGKLGMNESLVHIDFMI----
    8 TLFDEN-----ASCHLALGKAYP-VCLKN-SESL-TQEDLSRQGANESLVHVDFMI----
    9 TLFDEN-----ASCHLALGKAYP-VCIKN-SEKM-SPDELAKLGVNDSLIHVDFMI----
   10 TLFDEN-----ASCHLAIGKAYP-ICLEG-AATL-NAKELEKAGVNDSLLHEDFMI----
   11 TLFDEN-----AACHLALGKAYA-VTLKN-GDKL-SEKELEEAGVNDSLLHEDFMI----
   12 TLFDEN-----AACHLALGKAYA-VTLKN-GDKL-SEKELEEAGVNDSLLHEDFMI----
   13 TLFDEN-----AACHLAIGKAYP-VCLEN-GDKL-SENELATAGVNESMVHEDFMI----
   14 TLFDEN-----ASCHLALGKAYP-VCLKN-GDRM-SKEELSRKGVNDSLVHVDFML----
   15 TLFDEN-----ASCHLAIGEAYP-TCLKN-SENM-SKEDLKNAGVNDSFEHVDFMI----
   16 TLFDEN-----ASCHLAIGEGYP-TCLEE-SQNM-SKEDLKNAGINSSLEHVDFMV----
   17 TLYDEN-----ASCHLAIGKAYP-VCIKG-GENM-TSEELEQHGVNESITHVDFMF----
   18 TLYDEN-----ASCHLAIGKAYP-VCLKN-GENM-NENELEKHGVNTSLVHEDFMI----
   19 TLYDEN-----ASCHLAFGKAYS-LCIKN-GENM-TNEELEKAGANDSLTHVDFMI----
   20 TLFDEN-----ASCHLALGQAYP-ICLEN-GSEM-DESQLREKGINISMVHEDFMV----
   21 TLFDEN-----ASCHLALGQAYP-ICLEN-GSEM-DESQLREKGVNISMVHEDFMV----
   22 TLFDEN-----ASCHLALGQAYP-VCLEN-GSEM-NESQLKEKGVNISMVHEDFMV----
   23 NLYDEN-----ASCHLALGGAYP-TCISG-SENQ-SEEELKNRGMNNSLIHEDFMI----
   24 TLFDEN-----ASCHLALGEAYP-TCIEN-GDNM-TKEELEKAGANNSLTHVDFMI----
   25 TLFDEN-----ASCHLALGEAYP-TCIEN-GDNM-TKEELEKAGANNSLTHVDFMI----
   26 TLFDEN-----ASCHFALGAAYP-TSIKG-GDKM-TDEELEQKGANTSLTHVDFMI----
   27 TLFDEN-----ASCHFAFGKAYP-SCLKG-SDNM-SEKELLEKGVNDSLTHIDFMV----
   28 TLFDEN-----ASCHFAFGKAYP-TCLKD-GDNM-SEEELIKNGANDSLTHVDFMV----
   29 TLFDEN-----AACHLALGKAYP-TCLKD-GEKM-DSVTLLQHGVNDSLMHEDFMV----
   30 TLFDEN-----ASCHLALGKAYP-TCIEG-GENM-DSVTLLQHGVNDSLVHEDFMV----
   31 TLFDEN-----AACHLAFGKAYP-TCIEG-GETM-TSVELLQRGVNDSLVHEDFMV----
   32 TLFDEN-----ASCHLAFGKAYP-TCIKG-GESM-TEDELRQHGVNHSLVHEDFMI----
   33 TLFDEN-----ASCHLALGKAYP-TCIEN-GEDM-TEDELRQHGVNHSLVHEDFMI----
   34 TLFDEN-----ASCHLALGKAYP-TCIRG-GDGM-TEEELLRHGVNHSLVHEDFMI----
   35 TLFDEN-----ASCHLALGKAYP-TCIRG-GDGM-TEEELLRHGVNHSLVHEDFMI----
   36 TLFDEN-----ASCHLALGKAYP-TCMQN-GENM-TEDELCRHGVNHSLVHEDFMI----
   37 TLFDEN-----ASCHLALGKAYP-TCMQN-GENM-TEDELCRHGVNHSLVHEDFMI----
   38 TLFDEN-----ASCHLALGKAYP-TCIRG-GEDM-TEDELRRAGVNDSIVHEDFMI----
   39 TLFDEN-----ASCHLALGKAYP-TCIRG-GEDM-TEDELRRAGVNDSIVHEDFMI----
   40 TLYDEN-----ASCHLALGSSYP-CCIKN-GEKM-TREESILSGSNVSLIHVDFMI----
   41 TLYDEN-----ASCHLALGSSYP-SCIKN-GENM-NKEQLLESKANFSLTHVDFMI----
   42 TLYDEN-----ASCHLALGSSYS-SCIKN-GESM-SEDELFKLGCNKSLSHVDFMI----
   43 TLFDEN-----AACHLAFGKAYP-TCIIN-GENL-STEELANKGANDSIIHVDFMI----
   44 TLFDEN-----ASCHFAIGSSYP-TNIEG-GTTM-TDEELEAAGANTSITHNDFMV----
   45 TLFDEN-----AACHIAFGEAYP--CLKG-GQKM-SRDELKKRGLNDSITHVDFMV----
   46 TLFDEN-----ASSHLAIGSAYP-LCIKD-GGKM-NKDQLEAHGANTSLTHVDFMI----
   47 TLFDEN-----ASCHIALGNALS-ICVEN-GKEM-SKDELKEIGFNESLTHVDFMI----
   48 TLFDEN-----ASCHLAIGHSYP-FNYQG-GRKM-TLDELSTHGANQSLMHVDFMI----
   49 TLFDEN-----ASCHLAIGNAYA-FNLVG-GKTM-SKEELAENGANASITHNDFMI----
   50 TLFDEN-----ASCHLAIGNAYA-FNLVG-GKTM-SKEELAENGANASITHNDFMI----
   51 TLFDEN-----ASCHLAIGNAYA-FNLVG-GKTM-SKEELAENGANASITHEDFMI----
   52 TLFDEN-----ASCHLAIGSAYA-FNLVG-GKTM-SKEELAENGANTSITHNDFMI----
   53 TLFDEN-----ASCHLAIGSAYA-FNLVG-GKTM-SKEELAENGANTSITHNDFMI----
   54 TLFDEN-----ASCHLAIGSAYA-FNLVG-GKTM-SKEELAENGANTSITHNDFMI----
   55 TLFDEN-----ASCHLAIGSAYA-FNLVG-GKTM-SKEELAENGANTSITHNDFMI----
   56 TLFDEN-----ASCHLAIGSAYA-FNLVG-GKTM-SKEELAENGANTSITHNDFMI----
   57 TLFDEN-----ASCHLAIGNAYA-FNLIG-GKTM-SKEELAENGANASITHEDFMI----
   58 TLFDEN-----ASCHLAIGNAYA-FNLVG-GKTM-SKEELAENGANASITHEDFMI----
   59 TLFDEN-----ASCHLAIGNAYA-FNLVG-GKTM-SKEELAENGANASITHEDFMI----
   60 TLFDEN-----ASCHLAIGNAYA-FNLDG-GKTM-TKEELAENGANSSITHEDFMI----
   61 TLFDEN-----ASCHLAIGNAYA-FNLEG-GKTM-TKEELAANGANASITHEDFMI----
   62 TLFDEN-----ASNHLAIGSSYS-FCLEG-GKTM-SKEELSQNGANDSITHVDFMI----
   63 TLFDEN-----ASNHLAIGSAYA-FNIEG-GKQM-SREELVKEGLNESITHVDFMI----
   64 TLFDEN-----ASNHLAIGSAYA-FNIEG-GKQM-SREELVKEGLNESITHVDFMI----
   65 TLFDEN-----ASNHLAIGSAYA-FNIEG-GKQM-SREELVKEGLNESITHVDFMI----
   66 TLYDEN-----ASNHLAIGSAYA-FNIEG-GKQM-TREELVKEGLNESITHVDFMV----
   67 TLYDEN-----ASNHLAIGSAYA-FNIEG-GKQM-TREELVKEGLNESITHVDFMV----
   68 TLFDEN-----ASNHLAIGSAYA-FNIEG-GKQM-SREELAKEGLNESITHVDFMI----
   69 TLFDEN-----ASNHLAIGSAYA-FNIEG-GKQM-SREELAKEGLNESITHVDFMI----
   70 TLFDEN-----ASNHLAIGSAYA-FNIEG-GKQM-SREELAKEGLNESITHVDFMI----
   71 TLYDEN-----ASNHLAIGSGYA-FNIEG-GKEM-KREELDAAGVNNSITHVDFMI----
   72 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKKM-SSEELAENGLNESLTHVDFMI----
   73 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKKM-SSEELAENGLNESLTHVDFMI----
   74 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKKM-SSTELAENGLNESITHVDFMI----
   75 TLFDEN-----ASNHLAIGSAYA-FCLEG-GKAM-SSDELKANGLNESITHVDFMI----
   76 TLFDEN-----ASNHLAIGSAYA-FCVEG-GKNM-SKDELEKAGLNNSITHVDFMI----
   77 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKQM-SKEELEENGLNTSITHVDFMI----
   78 TLFDEN-----ASNHLAIGNAYS-VNIEG-GADM-SNEELASRGINISLTHVDFMI----
   79 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKSM-SSDELKAHGLNESITHVDFMI----
   80 TLFDEN-----ASNHFAIGSAYA-FCLEG-GKTM-SQEELLENGLNQSITHVDFMI----
   81 TLFDEN-----ASNHLAIGSAYA-FCLDG-GKEM-SSEQLQANGLNQSLTHVDFMI----
   82 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKDM-SSDELAAHGINQSLTHVDFMI----
   83 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKEM-TSDELAAHGINQSLTHVDFMI----
   84 TLFDEN-----ASNHFAIGSAYA-FCIEG-GKEM-TSEELSAYGLNQSLTHVDFMI----
   85 TLFDEN-----ASNHLAIGSGYA-FNIEG-GKKM-SREELDANGVNNSITHVDFMI----
   86 TLFDEN-----ASNHLAIGSAYA-FNLAG-GQSM-SKEELEQKGLNHSLTHVDFMI----
   87 TLFDEN-----ASNHLAIGSGYA-FNIDG-GKQM-SPEELAENGVNASITHVDFMI----
   88 TLFDEN-----ASNHLAIGSGYA-FNVEG-GKQM-SPDELVAAGVNASITHVDFMI----
   89 TLFDEN-----ASNHLALGSAYA-FCLEG-GKDM-NQEQLIQSGLNTSVTHVDFMI----
   90 TLFDEN-----ASNHLALGSAYA-FCLEG-GKDM-NQEQLIQNGLNTSVTHVDFMI----
   91 TLFDEN-----ASNHLALGSAYA-FCIEG-GKEM-NQEQLIQSGLNTSVTHVDFMI----
   92 TLFDEN-----ASNHLALGSAYA-FCLEG-GKDM-NQEQLAQKGLNTSVTHVDFMI----
   93 TLFDEN-----ASNHLAIGNAYA-FNLKG-GKDM-TQEQLAANGLNSSLTHVDFMI----
   94 TLFDEN-----ASNHLAIGNAYA-FNLKG-GKDM-TQEQLAANGLNSSLTHVDFMI----
   95 TLFDEN-----ASNHLAIGNAYA-FNLKG-GKEM-TAEELAANGLNFSLTHVDFMI----
   96 TLFDEN-----ASNHLAIGNAYA-FNLEG-GKSM-SQEELAQRGLNSSLAHEDFMV----
   97 TLFDEN-----ASNHLAIGSAYA-FNLEG-GKGL-SQEELKARGLNTSITHVDFMI----
   98 TLFDEN-----ASCHLAIGSAYA-FNLEG-GKTM-TSEQLQASGLNTSITHVDFMM----
   99 TLFDEN-----ASCHLAIGSAYA-FNLEG-GKTM-TSEQLQASGLNTSITHVDFMM----
  100 TLFDEN-----ASCHLAIGSAYA-FNLEG-GKTM-TPEQLQEHGLNSSITHVDFMM----
  101 TLFDEN-----ASCHLAIGSAYA-FNLEG-GKTM-TSDQLQASGLNTSITHVDFMM----
  102 TLFDEN-----ASHHLAIGNAYS-FALEG-GKQM-SEEDLEAAGANSSITHVDFMI----
  103 TLFDEN-----ASNHLAIGSAYA-FCIEG-GKEM-SKEELEKNDLNTSNTHVDFMI----
  104 TLFDEN-----ASNHLAIGTAYA-FNIEG-GKEM-SEEELEQAGINTSITHVDFMI----
  105 TLFDEN-----ASNHLALGSAYA-FNIEG-GKTM-SPEELEKNGLNQSITHVDFMM----
  106 TLYDEN-----ASNHIALGSAYP-TNLQG-GAKM-SNEELEANGINTSMTHVDFMI----
  107 TLYDEN-----ASNHIALGSAYP-TNLKG-GADM-NKEELEQAGLNVSITHVDFMI----
  108 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  109 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  110 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  111 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  112 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  113 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  114 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  115 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  116 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEAAGVNNSLTHVDFMI----
  117 TLFDEN-----ASNHLAIGSAYA-FNVKG-GEEM-SREELEKMGVNNSRTHVDFMI----
  118 TLFDEN-----ASNHLAIGSAYA-FNIKN-GENM-SRAELDARGVNTSLTHVDFMI----
  119 TLFDEN-----ASCHLALGRAYS-TCLEG-GPSM-SQEELAANGANDSMTHVDFMI----
  120 TLFDEN-----ASCHLAIGRAYS-TCLEN-GPSL-SNEELAAQGANDSMTHVDFMI----
  121 TLFDEN-----AACHLALGKAYP-TNIEN-GASL-SKEELDRRGVNDSLVHVDFMI----
  122 TLFDEN-----AACHLALGKAYP-TNIEN-GASL-SKEELDRRGVNDSLVHVDFMI----
  123 TLFDEN-----AACHLALGKAYP-TNIKS-GASL-SKDELDRRGVNDSLVHVDFMI----
  124 TLFDEN-----AACHLALGKAYP-TNIEN-GASL-SKDELDRRGVNDSLVHVDFMI----
  125 TLFDEN-----AACHLALGKAYP-TNIEN-GASL-SKDELDRRGVNDSLVHVDFMI----
  126 TLFDEN-----AACHLALGKAYP-TNIEN-GASL-SKEELDRRGVNDSLVHVDFMI----
  127 TLFDEN-----AACHFALGKAYP-TNIEN-GAAL-SNEELGRRGVNDSLVHVDFMI----
  128 TLFDEN-----AACHFALGKAYP-TNIEN-GAAL-SNEELGRRGVNDSLVHVDFMI----
  129 TLFDEN-----AACHLALGKAYP-TNIQN-GTAM-SKEELDKHGVNDSLIHEDFMI----
  130 TLFDEN-----AACHLALGKAYP-TNIQN-GTAM-SKEELDKHGVNDSLIHEDFMI----
  131 TLFDEN-----AACHLALGKAYP-TNIQN-GTAM-SKEELDKHGVNDSLIHEDFMI----
  132 TLFDEN-----AASHLALGKAYP-TNIEG-GTNM-RTEELLARGANDSLVHEDFMI----
  133 TLFDEN-----ASSHLALGQAYP-VNMDG-GTEM-KEEELSQHGANSSLVHVDFMI----
  134 TLYDEN-----ASCHLALGKAYP-TNIKD-GSSF-DEEQMDHHGVNDSLVHEDFMM----
  135 TLFDEN-----ASCHIALGKAYP-TNLEG-GAAM-DDQELDKHGVNDSLTHVDFMI----
  136 TLFDEN-----ASCHIALGKAYP-TNVEG-GSAM-SDEELDKAGVNDSLTHVDFMI----
  137 TLFDEN-----ASCHIALGKAYP-TNLKG-GSAM-DLDELDKHGVNDSLIHVDFMI----
  138 TLYDEN-----ASCHLALGKAYP-NNMTG-GSDM-SEEELDQNGINHSLSHVDFMM----
  139 TGLDEN-----ASCHLALGNAYP-LCLEG-GTAM-TREQLAQHGANHSLVHVDFMI----
  140 TLFDEN-----ASNHLALGNAYP-TCVQG-GAAM-TREELEQAGLNQSILHVDFMI----
  141 TIFDEN-----ASCHLALGSAYS-SCIKG-GAGL-SREELLERGLNQSMAHTDFMV----
  142 TLFDEN-----ASNHLAIGEAYP-TCLEG-GRDL-ENGQLEALGANISVTHEDFMI----
  143 TLFDEN-----ASNHLAIGEAYP-TCLEG-GRDL-ENGQLEALGANISVTHEDFMV----
  144 TLFDEN-----ASNHLAIGEAYP-TCLEG-GRDL-ENGQLEALGANISVTHEDFMI----
  145 TLFDEN-----ASNHLAIGKAYP-TCLEG-GRDL-ENDQLETLGANISVTHEDFMI----
  146 TLFDEN-----ASNHLAIGKAYP-TCLEG-GRDL-ENDQLETLGANISVTHEDFMI----
  147 TLFDEN-----ASNHLAIGKAYP-TCLED-GRDL-ENDQLETLGANISVTHEDFMI----
  148 TLFDEN-----ASNHLAIGKAYP-TCLED-GRDL-ENDQLETLGANISVTHEDFMI----
  149 TLFDEN-----ASNHLAIGKAYP-TCLEG-GRDL-ENDQLETLGANISVTHEDFMI----
  150 TLFDEN-----ASNHLAIGKAYP-TCLEG-GRDL-ENDQLETLGANISVTHEDFMI----
  151 TLFDEN-----ASNHLAIGKAYP-TCLEG-GRDL-ENDQLETLGANISVTHEDFMI----
  152 TLFDEN-----ASNHLAIGEAYP-TCYEG-GKEL-EKGQLEALGINTSITHEDFMI----
  153 TLFDEN-----ASNHLAIGDSYP-TCYEG-ARDL-ERKQLAAIGLNTSLVHEDFMI----
  154 TGIDEN-----ASCHFAVGSAYP-FTIEN-GTKM-TKEELLAKGANVSLTHVDFMV----
  155 TGIDEN-----ASCHFAVGSAYP-FTLEN-GTKM-SQEELLARGANVSLTHVDFMV----
  156 TGIDEN-----ASCHFALGSAYP-VNIEG-GTKM-SKEELLARGANVSLTHVDFMI----
  157 TGIDEN-----ASCHFALGSAYP-VNIEG-GTKM-SKEELLARGANVSLTHVDFMI----
  158 TGIDEN-----ASCHFALGSAYP-VNIEG-GTKL-SKEELLARGANVSLTHVDFMI----
  159 TGIDEN-----ASCHFALGSAYP-VNIEG-GTKL-SKEELVARGANVSLTHVDFMV----
  160 TGIDEN-----ASCHLALGSAYP-FNIEN-GTQM-NREELLQNGANVSLTHVDFMI----
  161 TGIDEN-----ASCHLALGSAYP-FNLEK-GTQM-NREELLQNGANVSLTHVDFMI----
  162 TGIDEN-----ASCHLALGSAYP-FNMEK-GTQM-SREELLKNGANVSLTHVDFMI----
  163 TGIDEN-----ASCHLALGSAYP-FNMEN-GTQM-NREELLQNGANVSLTHVDFMI----
  164 TLYDEN-----ASCHFAIGSAYK-TCLEG-GNNL-KDEELDEHGVNDSLTHVDFMI----
  165 TLYDEN-----ASCHFAIGSAYS-SCIEG-GNDI-KAEDFDKYGINDSLTHVDFMV----
  166 TLFDEN-----ASCHLAIGSAYR-SCIEN-GNDL-KEEELDKLGVNDSLTHVDFMV----
  167 TLFDEN-----ASCHLAIGAAYS-SCIEN-GASF-SEEEKDQIGMNVSMTHVDFMI----
  168 TLFDEN-----ASCHLAIGAAYS-SCVKD-GANI-AEEDKDGLGINVSITHVDFMI----
  169 TLYDEN-----ASCHLAIGKAYP-TCLDG-GTKM-SAEELAAHGANTSLIHVDFMI----
  170 TLFDEN-----ASCHLALGKAYP-TCIKG-GNDL-DEAGLDQAGVNDSLIHEDFMV----
  171 TLFDEN-----ASNHLALGSAYA-FSLQG-GTEM-SEEELAAAGLNRSQTHVDFMV----
  172 TLFDEN-----ASNHLALGSAYA-FSLQG-GTEM-SEEELAAAGLNRSQTHVDFMV----
  173 TLFDEN-----ASNHLALGSAYA-FSLQG-GTEM-SEEELAAAGLNRSQTHVDFMV----
  174 TLFDEN-----ASNHLAFGSAYA-FNLQG-GTEM-SEEELAEAGLNRSQTHVDFMV----
  175 TLFDEN-----ASNHLAFGSAYA-FNLQG-GTEM-SEEELAEAGLNRSQTHVDFMV----
  176 TLFDEN-----ASNHLAFGSAYA-FNLQG-GTEM-SEEELAEAGLNRSQTHVDFMV----
  177 TLFDEN-----ASNHLAFGSAYA-FNLQG-GTEM-SEEELAEAGLNRSQTHVDFMV----
  178 TLFDEN-----ASNHLAFGSAYA-FNLQG-GTEM-SEEELAEAGLNRSQTHVDFMV----
  179 TLFDEN-----ASNHLALGSAYA-FSVKG-GTEM-SDEELAEAGLNRSQTHVDFMV----
  180 TLFDEN-----ASNHLALGSAYA-FNLQD-GTEM-SDEELKERGLNLSQTHVDFMV----
  181 TLFDEN-----ASNHLALGAAYA-FSVTG-GTEM-TEEELKQAGLNRSQTHVDFMV----
  182 TLFDEN-----ASNHLALGSAYA-FSLIG-GTEM-SEEELKAAGLNRSTVHVDFMI----
  183 TLFDEN-----ASNHLALGSAYA-FSLIG-GTEM-SEEELQAAGLNRSTVHVDFMI----
  184 TLFDEN-----ASNHVALGSAYA-FSLEG-GTEM-SEDELKEAGLNRSTTHVDFMI----
  185 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  186 TLFDEN-----ASNHLAIGAAYA-TSVVG-GADM-SEEELEAAGLNRSDVHVDFMI----
  187 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  188 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  189 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  190 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  191 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  192 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  193 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  194 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  195 ------------------------------------------------------------
  196 TLFDEN-----ASNHLAIGAAYA-TSVVD-GAEM-SEEELEAAGLNRSDVHVDFMI----
  197 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  198 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-IEEELEAAGLNRSDVHVDFMI----
  199 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  200 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELEAAGLNRSDVHVDFMI----
  201 TLFDEN-----ASNHLAIGAAYA-TSVVG-GAEM-SEEELATAGLNRSDVHVDFMI----
  202 TLFDEN-----ASNHLAIGAAYA-TSVEG-GAEF-TEEELEAAGLNRSDVHVDFMI----
  203 TLFDEN-----ASNHLAIGAAYA-TSVEG-GAEF-TEEELEAAGLNRSDVHVDFMI----
  204 TLFDEN-----ASNHLAIGAAYA-TSVEG-GAEF-TEEELEAAGLNRSDVHVDFMI----
  205 TLFDEN-----ASNHLAIGAAYA-TSVEG-GAEF-TEEELEAAGLNRSDVHVDFMI----
  206 TLFDEN-----ASNHLAIGAAYA-TSVVG-GENF-SEEELEAAGLNRSDVHVDFMI----
  207 TLFDEN-----ASNHLAIGAAYA-TSVVG-GENF-SEEELEAAGLNRSDVHVDFMI----
  208 TLFDEN-----ASNHLAIGAAYA-TSVVG-GENF-SEEELEAAGLNRSDVHVDFMI----
  209 TLFDEN-----ASNHLAIGAAYA-TSVVG-GENF-SEEELEAAGLNRSDVHVDFMI----
  210 TLFDEN-----ASNHLAIGAAYA-TSVVG-GENF-SEKELEAAGLNRSDVHVDFMI----
  211 TLFDEN-----ASNHLAIGAAYA-TSVVG-GENF-SEKELEAVGLNRSDVHVDFMI----
  212 TLFDEN-----ASNHLAIGAAYA-TSVKG-GADM-TEEELKEAGLNRSDVHVDFMI----
  213 TLFDEN-----ASNHLAIGAAYA-TSVEG-GADM-TEEELKEAGLNRSDVHVDFMI----
  214 TLFDEN-----ASNHLAIGAAYA-TSVEG-GADM-TEEELKAAGLNRSDVHVDFMI----
  215 TLFDEN-----ASNHLAIGAAYA-TSVEG-GADM-TEEELKAAGLNRSDVHVDFII----
  216 TLFDEN-----ASNHLAIGAAYA-TSVEG-GADM-TEEELKAAGLNRSDVHVDFII----
  217 TLFDEN-----ASNHLAIGQAYA-FSIEG-GTEM-SQEELKEAGLNRSDVHVDFMI----
  218 TLFDEN-----ASNHLAIGSAYA-TSVKG-GENFETEEELREAGLNRSDVHVDFMI----
  219 TLYDEN-----ASNHLAIGSAYA-TSVKG-GEKFETEEELAAAGLNRSDVHVDFMI----
  220 TLFDEN-----ASNHLAIGAAYP-TTIQG-GTKM-SEEELLKHGMNVSNVHVDFMI----
  221 TLFDEN-----ASNHLAIGAAYA-FSLKG-GTEM-SQEELKAAGLNRSTAHVDFMI----
  222 TLFDEN-----ASNHLAIGAAYA-FSLKG-GTEM-SQEELKAAGLNRSTAHVDFMI----
  223 TLFDEN-----ASNHLAIGAAYA-FSLKG-GTEM-NNEELKAAGLNRSTAHVDFMI----
  224 TLFDEN-----ASNHLAIGAAYA-FSLKG-GTEM-NNEELKAAGLNRSTAHVDFMI----
  225 TLFDEN-----ASNHLAIGAAYA-FSIKG-GTEM-TNEELKAAGLNRSTAHVDFMI----
  226 TLFDEN-----ASNHLAIGSAYA-FNLKG-GTEM-SNEDLKAAGLNRSTTHVDFMI----
  227 TLFDEN-----ASNHLAIGQAYA-FSLEG-GTEM-SQEELKAAGLNRSTAHVDFMI----
  228 TLFDEN-----ASNHLAIGAAYA-FSIKD-GTEM-TNDELKAAGLNRSTAHVDFMI----
  229 TLFDEN-----ASNHLAIGSAYA-FSVKG-GTEM-TQEQLKEAGLNRSSAHVDFMI----
  230 TLFDEN-----ASNHLAIGSAYA-FNVEG-GTEM-TSQELDEAGLNRSSTHVDFMI----
  231 TLFDEN-----ASNHIALGQAYA-SSVQG-GTQM-TQEELAQAGLNRSNVHVDFMV----
  232 TLFDEN-----ASNHIALGQAYA-TSIQD-GTKM-SQDQLKAAGLNRSTVHVDFMI----
  233 TLFDEN-----ASNHLAIGQAYA-TSVQG-GTDM-SQEELAQAGLNRSIVHVDFMI----
  234 TLFDEN-----ASNHLAIGAAYP-TTVKG-GTEM-SEEELQAAGINRSHVHVDFMI----
  235 TLFDEN-----ASNHMALGAAYP-FSIQG-GTKM-LDEELKEHGINISQTHVDFMM----
  236 TLFDEN-----ASNHMALGAAYP-FSIQG-GTKM-SDEELKEHGINISQTHVDFMM----
  237 TLFDEN-----ASNHLALGSAYP-FSIQD-GTTM-DDEALAAAGLNLSQIHVDFMM----
  238 TLFDEN-----ASDHLALGASYP-FNVAG-GTKM-SDEELLDHGMNVSQTHVDFMV----
  239 TLYDEN-----ASDHMALGAAYP-FSVVG-GTEM-SPVELDQAGLNSSQEHVDFMM----
  240 TLYDEN-----ASDHLALGAAYP-FNVQG-GREM-SNEELLEHGVNVSKTHVDFMV----
  241 TLFDEN-----ASDHMALGQAYP-FSVKD-GVAM-TNEQRAAAGLNQSPTHVDFMM----
  242 TLYDEN-----ASDHMALGQAYP-FSVKD-GMAM-NAEQRRTAGLNQSPTHVDFMM----
  243 TLYDEN-----ASDHMALGQAYP-FSVKD-GVAK-TTDQRTAAGLNQSNTHVDFMM----
  244 TLYDEN-----ASDHMALGQAYP-FSVKD-GVAM-TTDQRTAAGLNQSNTHVDFMM----
  245 TLYDEN-----ASDHMALGQAYP-FSVKD-GVAM-TTDQRTAAGLNQSNTHVDFMM----
  246 TLFDEN-----ASNHLALGSAYA-FSIEG-GTDM-SEEELKAAGLNRSQAHVDFMV----
  247 TLFDEN-----ASNHLALGSAYA-FSIKG-GTDM-TQEELKAAGLNRSQAHVDFMV----
  248 TLFDEN-----AANHLAFGSAYP-FSIKD-GTSM-IDAQLKAAALNTSQLHVDFMV----
  249 TLIDEN-----ASDHLALGAAYP-SNIKN-GTQL-SVPERQAKGQNDSIVHVDFMI----
  250 TLIDEN-----ASDHLALGAAYP-SNIKN-GTQL-SVADRQAKGQNDSIVHVDFMI----
  251 TLIDEN-----ASDHLALGAAYP-FNLKG-GTQM-DVAARQAKGQNESLVHVDFMM----
  252 TLIDEN-----ASNHLALGAAYP-FNINN-GTQM-SDEQRQNKGENLSIIHVDFMM----
  253 TLFDEN-----ASDHLALGAAYN-SNITG-GKTE-APEVLAQRGWNISDVHVDFMI----
  254 TLFDEN-----ASDHLAIGAAYN-SNITG-GKTE-APEVLAQRGWNISDVHVDFMI----
  255 TLFDEN-----ASDHLAIGAAYA-SNIAG-GKTD-QPEDLAKRGWNISDVHVDFMV----
  256 TLFDEN-----ASDHLAIGAAYA-SNITG-GKTD-KPEDLAKRGWNISDVHVDFMI----
  257 TLFDEN-----ASDHLAIGAAYA-SNITG-GKTD-KPEDLAKRGWNISDVHVDFMI----
  258 TLFDEN-----ASDHLAIGAAYA-SNISG-GKTE-KPKNLAKRGWNISDEHVDFMI----
  259 TLFDEN-----ASDHLAIGAAYA-SNISD-GKTA-SPESLASRGWNISDVHVDFMI----
  260 TLFDEN-----ASDHLAIGAAYA-SNIKD-GKTA-SPEALAQRGWNISDTHVDFMI----
  261 TLFDEN-----ASDHVAIGQAYN-TNIQK-GEEL-DERTLASYGWNQSDVHVDFMI----
  262 TLFDEN-----ASDHVALGEAYP-FTIKG-GTNW-NVDELRKHGMNVSRNHVDFMI----
  263 TLFDEN-----ASDHMALGEAYP-FTIEN-GSSM-TPDELQRHGMNISQTHVDFMV----
  264 TLFDEN-----ASNHLALGAAYP-TTLKD-GTKM-TEEELEKAHINQSISHVDFMI----
  265 TLFDEN-----ASNHLALGAAYP-TNVKN-GTKM-TEEELEKAHINQSISHVDFMI----
  266 TLFDEN-----ASNHLALGAAYP-TNVKG-GKDM-SEEELEKAHLNQSITHVDFMI----
  267 TLFDEN-----ASCHLALGSAYP-FCLEG-GKEL-DDAGLDAAGLNNSITHEDFMI----
  268 TLFDEN-----ASCHLAIGSAYG-FNVKG-GTEM-STEEKLAAGLNDSNVHEDFMI----
  269 TLFDEN-----ASCHLAIGSAYG-FNVKG-GNEM-STEEKLAAGLNDSNVHEDFMI----
  270 TLFDEN-----ASCHLAIGSAYG-FNVKG-GTEM-TTEEKIASGLNDSNVHEDFMI----
  271 TLFDEN-----ASCHLAIGSAYS-FNIKG-GTEM-TTEEKIANGLNDSNIHEDFMI----
  272 TLFDEN-----ASCHLAIGSAYS-FNIKG-GTEM-TTEEKIANGLNDSNIHEDFMI----
  273 TLFDEN-----ASCHLAIGSAYS-FNIKG-GTEM-TTEEKIANGLNDSNIHEDFMI----
  274 TLFDEN-----ASCHLAIGSAYG-FNIKG-GTEM-STEEKIASGLNDSNVHVDFMI----
  275 TLFDEN-----ASCHLALGSAYG-FNIEG-GTEM-TTEEKIASGLNDSNVHEDFMI----
  276 TLFDEN-----ASCHLAIGSAYG-FNIEG-GTEM-TTEEKIASGLNDSNVHEDFMI----
  277 TLFDEN-----ASCHLAIGSAYG-FNVEG-GTEM-TTEEKIASGLNDSNVHVDFMI----
  278 TLFDEN-----AACHLAIGSAYA-FNIQG-GTEM-TVEEKIASGLNDSNVHVDFMI----
  279 TLFDEN-----AACHLAIGSAYA-FNIQG-GTEM-TVEEKIASGLNDSNVHVDFMI----
  280 TLFDEN-----AACHLAIGSAYA-FNIQG-GTEM-TVEEKIASGLNDSNVHVDFMI----
  281 TLFDEN-----AACHLAIGSAYA-FNIQG-GTEM-TVEEKIASGLNDSNVHVDFMI----
  282 TLFDEN-----ASCHLAIGSAYA-FNVEG-GTEM-SVEEKVACGLNDSNVHVDFMI----
  283 TLFDEN-----ASCHLAIGSAYA-FNLKG-GTEM-STDEQIAHGLNDSNVHVDFMI----
  284 TLFDEN-----ASCHLAIGSAYG-FNVKG-GTEM-TTEEKLASGLNDSNVHVDFMI----
  285 TLFDEN-----ASCHIALGAAYA-FNIQG-GTEM-TTEEKIEHGLNDSLIHVDFMI----
  286 TLFDEN-----ASCHIALGSAYG-FNVEG-GTEM-TTEEKLAHGLNDSLIHVDFMI----
  287 TLFDEN-----ASCHIALGSAYG-FNVKG-GTEM-STEEKLESGLNDSLVHVDFMI----
  288 TLLDEN-----ASCHIALGAGYP-FTIKD-GTSM-SREELSSEGLNDAFIHEDFMI----
  289 TLFDEN-----ASCHIALGAAYA-FNLQG-GTEM-TAEELKAHGLNDSLTHVDFMI----
  290 TLFDEN-----ASCHIALGAAYP-TTIKG-GNEM-SPEELLENNVNDSIIHVDFMI----
  291 TLFDEN-----ASCHLALGKAYP-TTIKN-GENM-SDEELAAHGVNDSLAHEDFMV----
  292 TLFDEN-----ASCHLALGKAYP-TTIKN-GENM-SDEELAAHGVNDSLAHEDFMV----
  293 TLYDEN-----ASCHLAFGQAYP-TCVEG-GVDM-TDDELKENGINDSLIHVDFMV----
  294 TLYDEN-----ASCHLAFGQAYP-TCVEG-GVDM-TDDELKENGINDSLIHVDFMV----
  295 TLYDEN-----ASCHLAFGQAYP-TCVEG-GVDM-NEDELKKNGINDSLIHVDFMV----
  296 TLYDEN-----ASCHLALGRAYP-TCLKD-GEKM-TDEELKERGANDSLVHVDFMV----
  297 TLYDEN-----ASCHLALGRAYP-TCLKD-GEKM-TEEELKERGANDSLVHVDFMV----
  298 TLYDEN-----ASCHLALGRAYP-TCLKD-GEKM-TEEELKERGANDSLVHVDFMV----
  299 TLYDEN-----ASCHLAIGKAYP-TCLAG-FENL-SSQDLLARGANDSLVHEDFMV----
  300 TLYDEN-----ASCHLALGKAYP-ICIKG-GESM-STEELIKNGANDSIIHVDFMI----
  301 TLYDEN-----AACHLALGKAYP-TSIKD-GDIM-SDDELINAGANDSLVHVDFMI----
  302 TLFDEN-----ASCHFALGAAYP-TCLEG-NEDM-SEEELLEAGVNDSLIHVDFMV----
  303 TLYDEN-----ASCHFALGKAYP-TCLKG-GENI-DEKDYDKYGINDSIVHVDFMV----
  304 TLYDEN-----ASCHFALGKAYP-TCLKG-GENI-DEKDYDKYGINDSIVHVDFMV----
  305 TLYDEN-----ASCHFALGKSYP-TCLEG-GEKL-SIEELKERGMNDSLTHVDFMV----
  306 TLFDEN-----AACHIALGKAYP-TCVKG-GPEM-SDEELSAVGANDSLIHVDFMI----
  307 TLFDEN-----AACHIALGKAYP-TCVQG-GPEM-TDEQLAEVGANDSLVHVDFMI----
  308 TLFDEN-----AACHIALGKAYP-TCVEG-GSEM-SDEELAAVGANDSLVHVDFMV----
  309 TLFDEN-----ASCHFALGKAYP-TTVKG-ASDL-DDSQVRSLGLNDSLIHEDFMV----
  310 TLFDEN-----ASCHFALGKAYP-TTVEG-GSDL-DDSKVKEIGLNDSLIHEDFMV----
  311 TLFDEN-----ASCHFALGKAYP-TCVEG-GADL-DDSEVKSIGINDSLIHEDFMV----
  312 TLFDEN-----ASCHFALGKAYP-TTVKG-GTEV-EDKDLHTIGLNDSLIHEDFMV----
  313 TLFDEN-----ASCHFALGKAYP-TTVKG-GTEV-DDKDLHKIGLNDSLIHEDFMV----
  314 TLFDEN-----ASCHFALGKAYP-TTVKG-GTEV-EDKDLHKIGLNDSLIHEDFMV----
  315 TLFDEN-----ASCHLAIGRAYP-L-IEG-GHEL-AHEDWEAHGLNDSLMHVDFMI----
  316 TLFDEN-----ASCHLAIGNAYP-L-IEG-GRDL-DRAAWRAAGLNQSLVHVDFMV----
  317 TLFDEN-----ASCHLALGDAYP-MNVAG-GVDM-SEEQLKEAGANHSMTHVDFMF----
  318 TLFDEN-----ASCHLALGDAYP-MNVAG-GVDM-SEEQLKEAGANHSMTHVDFMF----
  319 TLFDEN-----ASCHLALGDAYP-MNVAG-GVDM-SEEQLKEAGANHSMTHVDFMF----
  320 TLFDEN-----ASCHLALGDAYP-MNVAG-GVDM-SEDQLKEAGANHSMTHVDFMF----
  321 TLFDEN-----ASCHLALGDAYP-MNVSG-GVDM-SEEELQAAGANHSMTHVDFMF----
  322 TLFDEN-----ASCHLALGDAYP-MNVEG-GIDM-NEEELNKAGANHSMTHVDFMF----
  323 TLFDEN-----ASCHLALGDAYP-MNVEG-GIDM-NEEELNKAGANHSMTHVDFMF----
  324 TLFDEN-----ASCHLALGNAYP-TCVEN-NDTL-SEEDFARLGVNVSLVHEDFMF----
  325 TLFDEN-----ASCHLALGRAYP-MNMEG-SQSM-SEEEMKAKGCNFSMVHVDFMF----
  326 TLFDEN-----AACHLALGMPYP-ENVKG-GAHM-SEEELKAAGANESSQHEDFMF----
  327 TLFDEN-----AACHLALGRAYP-ENIKG-GLTD-DEESLKKRGMNTSFQHVDFMF----
  328 TLFDEN-----ASCHMALGRAYP-MNLKG-GTEM-TGEELLAHNANDSLNHEDFMF----
  329 TLFDEN-----ASCHMALGRAYP-MNIKN-GNQT-PIEELEKKGYNNSMTHVDFMF----
  330 TLFDEN-----AASHFAFGRAYP-NCIKD-GTKM-NEEQLRQNGLNTSLTHVDFMV----
  331 TLFDEN-----AASHFAFGRAYP-NCIKN-GEKL-SEKELLKAGINTSLTHVDFMI----
  332 TLFDEN-----AASHFAFGKAYP-ICIKD-GTKM-SEEELKEHGLNTSITHVDFMI----
  333 TLYDEN-----AASHFALGRAYP-TCVED------FSGDPEKDGINMSLTHVDFMV----
  334 TLYDEN-----AASHFAFGRAYP-TCVED------FDGDAEKSGINMSLTHVDFMV----
  335 TLYDEN-----ASCHFALGSAYP-NCIKN-GENM-TKEEREKAGVNDSIIHVDFMV----
  336 TLFDEN-----ASCHLALGKAYP-TCLAG-GTNL-SDEEAAAAGLNDSMVHVDFMI----
  337 TLLDEN-----ASCHLALGKAYP-TCLAG-GTAM-ADAELKAAGLNDSIVHADFMI----
  338 TLLDEN-----ASCHLALGDAYP-TCVEK-GAEM-DEEELKKAGLNDSMIHVDFMV----
  339 TLFDEN-----ASCHLALGASYP-TCLAG-GADM-DKDAIAAAGLNDSMIHVDFMV----
  340 TLLDEN-----ASCHLALGAAYP-TCIQN-GSAM-TKEELQQAHINDSVIHVDFMI----
  341 TLLDEN-----ASCHLALGAAYP-TCIQN-GSAM-TKEELQQAHINDSVIHVDFMI----
  342 TLFDEN-----ASCHLAIGASYP-TCLKN-SDGL-SEEELKERGLNYSLTHVDFMI----
  343 TLFDEN-----ASCHLAIGASYP-TCLKN-SDGL-SEEELKERGLNHSLTHVDFMI----
  344 TLFDEN-----ASCHLAIGASYP-TCLKD-SNGL-SEEELKERGLNHSLTHVDFMI----
  345 TLFDEN-----ASCHLAIGASYP-TCLKN-SDGL-SDDELKERGLNHSLTHVDFMI----
  346 TLFDEN-----ASCHLAIGASYP-TCLKN-SDGL-SDDELKERGLNHSLTHVDFMI----
  347 TLFDEN-----ASCHLAIGASYP-TCLKN-SDGL-SDDELKERGLNHSLTHVDFMI----
  348 TLFDEN-----ASCHLAIGAAYP-TCLKN-SDGL-SEDELKERGLNHSLAHVDFMI----
  349 TLYDEN-----ASCHLALGAAYP-TCLAH-SDGL-SQEELHARGLNTSLAHTDFMI----
  350 TLFDEN-----ASCHFAIGNAYS-ENIAD-GANL-SDERKKEVGMNNSVIHVDFMV----
  351 TLFDEN-----ASCHFAIGNAYS-ENIKG-GAEF-SDEDKKKIGMNNSIIHVDFMV----
  352 TLFDEN-----ASVHFALGRAYS-YAMQN-GSNL-TEEELKAKGANFSLIHTDFMV----
  353 TLFDEN-----AACHIAFGDSYP-GTTVG-GTGL-SKEELAARGMNHSSLHEDVMI----
  354 TLFDEN-----AACHIAFGKGYP-GTVKG-GTAM-TKQELLAHGVNDSIIHEDVMV----
  355 TLFDEN-----AACHIAFGAGYP-TNIRG-GASM-TRAQLMEKGLNDSAIHEDVMI----
  356 TLFDEN-----AASHIAFGQAYQ-ENLEG---RP-SGEAFRKRGGNESLVHVDWMI----
  357 TLFDEN-----AASHIAFGQAYA-ENLEG---RP-SGEAFRKRGGNESLVHVDWMI----
  358 TLFDEN-----AASHIAFGQAYA-ENLEG---RP-SGEAFRKRGGNESLVHVDWMI----
  359 TLFDEN-----AASHIAFGQAYT-ETLEG---RP-TGEDFRKRGGNESLVHIDWMI----
  360 TLFDEN-----AASHIAFGQAYA-ENLEG---RP-SGEEFRRRGGNESMVHVDWMI----
  361 TLFDEN-----AASHIAFGQAYA-ENLEG---RP-TGEEFRKRGANESLVHIDWMI----
  362 TLFDEN-----AASHIALGQALA-LNMEG-GCD-------AARGANESLIHVDWMI----
  363 TLFDEN-----AASHIALGQALA-LNMEG-GCD-------AARGANESLIHVDWMI----
  364 TLFDEN-----AASHIALGQAYS-ECIRG-GDRL-SREELAARGANASLIHVDWMI----
  365 TLFDEN-----AASHIALGQAYS-ECIQG-GSQL-SPEELEAKGANRSLIHIDWMI----
  366 TLFDEN-----AACHIALGQSYA-KCIRN-GVGM-DEAALAGKGANKSLIHIDWMI----
  367 TLYDEN-----AASHIALGQSYS-KCFIN-GSAL-TPEELTARGANSSLIHIDWMI----
  368 TLYDEN-----AASHIALGQAYS-KCFRNGGQGL-SEVDLAARGANRSLIHIDWMI----
  369 TLYDEN-----AASHIALGQAYS-KCFREGGQGL-SEEDLAARGANRSLIHIDWMI----
  370 TLYDEN-----AASHIALGQAYS-KCFRNGGDGL-SESDLAERGANRSLIHIDWMI----
  371 TLYDEN-----AASHIALGQAYS-KCFRNGGDGL-SESDLAERGANRSLIHIDWMI----
  372 TLYDEN-----AASHIALGQAYS-KCFRNGGDGL-SESDLAERGANRSLIHIDWMI----
  373 TLYDEN-----AASHIALGQAYS-KCFRNGGEGL-SEADLAERGANRSLIHIDWMI----
  374 TLFDEN-----AASHIALGQCYS-KCFVD-GEKL-SPEQIAAQGGNKSFIHIDWMI----
  375 TLFDEN-----AASHIALGQCYS-KCFVG-GEKL-SPEQIAAQGGNKSFIHIDWMI----
  376 TLFDEN-----AACHIALGQCYS-KCFVD-GAKL-SPEQISAQGGNKSFIHIDWMI----
  377 TLFDEN-----AACHIALGQCYS-KCFLD-GANL-SAEQIAAQGGNKSLIHIDWMI----
  378 TLFDEN-----AASHIALGQCYS-KCFIN-GTSL-SPQQIAAQGGNQSLIHIDWMI----
  379 TLFDEN-----AASHIALGQCYS-KCFVN-GTSL-SPQQIAAQGGNQSLIHIDWMI----
  380 TLFDEN-----AASHIALGQCYS-KCFVN-GTSL-SPQQIAAQGGNQSLIHIDWMI----
  381 TLFDEN-----AASHIALGQCYS-KCFVN-GTSL-SPQQIAAQGGNQSLIHIDWMI----
  382 TLFDEN-----AASHIALGQCYS-KCFVN-GTSL-SPQQIAAQGGNQSLIHIDWMI----
  383 TLFDEN-----AASHIALGQCYA-KCFVD-GTKL-SQEQIAAQGGNRSLIHIDWMI----
  384 TLFDEN-----AASHIALGQCYS-KCFVN-GAQL-TPQQIAAQGGNQSLIHIDWMI----
  385 TLFDEN-----AASHIALGQCYS-KCFVN-GAQL-TPQQIAAQGGNQSLIHIDWMI----
  386 TLFDEN-----AASHIALGQCYS-KCFVN-GAQL-TPQQIAAQGGNQSLIHIDWMI----
  387 TLFDEN-----AASHIALGQCYS-KCFVN-GAQL-TPQQIAAQGGNQSLIHIDWMI----
  388 TLFDEN-----AACHIALGQCYS-KCFVD-GASL-SQDEIAARGGNKSFIHIDWMI----
  389 TLFDEN-----AACHIALGQCYS-KCFVD-GASL-SQDEIAARGGNKSFIHIDWMI----
  390 TLFDEN-----AACHIALGQCYS-KCFVD-GASL-SPDEIAARGGNKSFIHIDWMI----
  391 TLFDEN-----AACHIALGQCYS-KCFVD-GASL-SQDEIAARGGNKSFIHIDWMI----
  392 TLFDEN-----AACHIALGQCYS-KCFVD-GASL-SQDEIAQRGGNKSFIHIDWMI----
  393 TLFDEN-----AASHIALGQCYS-KCFLQ-GDRL-TPEQIAQQGGNTSLIHIDWMI----
  394 TLFDEN-----ASCHIALGQCYS-KCFLD-GANL-SQEQIKAQGGNSSLIHIDWMI----
  395 TLFDEN-----ASCHIALGQCYS-KCFLD-GATL-SQEQIKAQGGNSSLIHIDWMI----
  396 TLFDEN-----ASCHIALGQCYS-KCFLN-GATL-SQEEIKAQGGNSSLIHIDWMI----
  397 TLFDEN-----ASCHIALGQCYS-KCFVD-GATL-SQEQITAQGGNSSLIHIDWMI----
  398 TLFDEN-----ASCHIALGQCYS-KCFLD-GASL-SQEQIRAQGGNASLIHIDWMI----
  399 TLFDEN-----ASCHIALGQCYS-KCFLD-GASL-SQEQIRARGGNSSLIHIDWMI----
  400 TLFDEN-----ASCHIALGQCYS-KCFLN-GASL-REEQIRAQGGNSSLIHIDWMI----
  401 TLFDEN-----ASCHIALGQCYS-KCFLN-GASL-SEEQIRAQGGNSSLIHIDWMI----
  402 TLFDEN-----ASCHIALGQCYS-KCFLD-GASL-TPEQIKAQGGNSSLIHIDWMI----
  403 TLFDEN-----ASCHIALGQCYS-KCFLD-GASL-SQDQIKAQGGNASLIHIDWMI----
  404 TLFDEN-----ASCHIALGQCYS-KCFLD-GASL-SQDQIKAQGGNSSLIHIDWMI----
  405 TLFDEN-----ASCHIALGQCYS-KCFLD-GASL-SQDQIKAQGGNSSLIHIDWMI----
  406 TLFDEN-----ASCHIALGQCYS-KCFVD-GASL-SQDQIKAQGGNSSLIHIDWMI----
  407 TLFDEN-----ASCHIALGQCYS-KCFVD-GASL-SQDQIKAQGGNSSLIHIDWMI----
  408 TLFDEN-----AASHIALGQCYS-KCFID-GAKL-TPEQIKTQGGNASLIHIDWMI----
  409 TLFDEN-----AASHIALGQCYS-KCFID-GAKL-TPEQIKAQGGNSSLIHIDWMI----
  410 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  411 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  412 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  413 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  414 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  415 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  416 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  417 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  418 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  419 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  420 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  421 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  422 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  423 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  424 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNLSLIHIDWMI----
  425 TLFDEN-----AASHIALGQCYS-KCFVD-GANL-TPEEIRARGGNSSLIHIDWMI----
  426 TLFDEN-----AASHIALGQCYS-KCFVD-GANL-TPEEIRARGGNSSLIHIDWMI----
  427 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  428 TLFDEN-----AASHIALGQCYS-KCFVD-GATL-TPEEIRARGGNSSLIHIDWMI----
  429 TLFDEN-----AACHIALGQCYS-DCFVD-GAKL-TPEQIKAQGGNSSLIHIDWMI----
  430 TLFDEN-----AACHIAMGQCYT-ECFVD-GDKL-TEDEVTEKGGNSSLIHIDWMI----
  431 TLFDEN-----AACHIALGQCYS-KCFLN-GAAL-TPEEIAMRGGNKSIIHIDWMI----
  432 TLFDEN-----AACHIALGQCYS-KCFLN-GAAL-TPEEIAMRGGNKSIIHIDWMI----
  433 TLFDEN-----AACHIALGQCYS-KCFLN-GAAL-TTEEIEMRGGNKSIIHIDWMI----
  434 TLFDEN-----AACHIALGQCYS-KCFLN-GAAL-TAEDIAMRGGNKSIIHIDWMI----
  435 TLFDEN-----AACHIALGQCYS-KCFLG-GSSL-TAEEIAMRGGNKSIIHIDWMI----
  436 TLFDEN-----AACHIALGQCYS-KCFLD-GASL-TSEEIAARGGNKSVIHIDWMI----
  437 TLFDEN-----AACHIALGQCYS-KCFLD-GASL-TSEEIAARGGNKSVIHIDWMI----
  438 TLFDEN-----AACHIALGQCYS-KCFLD-GASL-TAEEISARGGNKSVIHIDWMI----
  439 TLFDEN-----AACHIALGQCYS-KCFLN-GASL-TPEEIAARGGNKSVIHIDWMI----
  440 TLFDEN-----AACHIALGQCYS-KCFLD-GASL-SAEEVAEKGGNASLIHVDWMI----
  441 TLFDEN-----AACHIALGQCYS-KCFLD-GASL-SAEEVAEKGGNASLIHVDWMI----
  442 TLFDEN-----AACHIALGQCYS-KCFLD-GASL-SPDQITAKGGNSSLIHVDWMI----
  443 TLYDEN-----AACHIALGQCYS-QCFEG-GDSL-SPDEIAARGGNASLIHVDWMI----
  444 TLFDEN-----AASHIALGQAYK-KCFVN-AKTL-TDEQFTAAGGNSSLIHVDWMI----
  445 TLFDEN-----AASHIALGQAYK-KCFTD-SESM-SDAEFATRGGNSSLIHVDWMI----
  446 TLFDEN-----ASCHIALGQCYA-DTIEG-GSEL-SPEELKQKGGNQSIIHVDWMM----
  447 TLFDEN-----ASCHIALGQCYA-DTIEG-GSEY-SAEELQQKGGNQSLIHVDWMM----
  448 TLFDEN-----AASHIALGQSYA-KCMLD-TDNL-TEAHLAQQGANTSFIHIDWMI----
  449 TLFDEN-----AASHIALGQSYA-KCMLD-TDSL-TEAHLAQQGANTSFIHIDWMI----
  450 TLFDEN-----AASHIALGQSYA-KCMLD-TDTL-TEAHLAQQGANSSFIHIDWMI----
  451 TLFDEN-----AASHIALGQSYA-KCMLD-TDSL-TEAHLARQGANSSFIHIDWMI----
  452 TLFDEN-----AASHIALGQSYT-KCMLD-TDTL-DAAQLSERGANSSFIHIDWMI----
  453 TLFDEN-----ASSHIALGQAYT-KCMLD-TENQ-TPEQIQARGANSSFIHIDWMI----
  454 TLFDEN-----ASSHIALGQAYT-KCMVD-IEGL-TPEELLERGVNDSLIHIDWMI----
  455 TLFDEN-----ASSHIALGQAYT-KCLFD-IEGL-TPEQLLERGANTSLIHIDWMI----
  456 TLFDEN-----AASHIALGQSYT-KCMRD-TAGL-DEAALAARGANSSMIHIDWMI----
  457 TLFDEN-----AASHIALGQSYT-KCMRD-TAGL-DEAALAARGANSSMIHIDWMI----
  458 TLFDEN-----AASHIALGQSYT-KCMRD-TAGL-DEAALAARGANSSMIHIDWMI----
  459 TLFDEN-----AASHIALGQAYT-KCMRD-TAGQ-DEAALAARGANSSMIHIDWMI----
  460 TLFDEN-----AACHIALGQCYS-KCFKN-GGKL-SSDEVIKRGGNSSMIHVDWMI----
  461 TLFDEN-----AACHIALGQAYS-TCVKN-GENM-KPEELAAKGANESLIHVDWMI----
  462 TLFDEN-----AASHIALGQAYT-SCLID-GDKA-SAEELAQRGANSSLIHVDWMI----
  463 TLFDEN-----AASHIALGQAYA-TCLIE-GEHM-DETTLAAKGANHSLIHVDWMI----
  464 TLFDEN-----AASHIALGQAYA-TCLID-GEHM-DDAKLASKGANSSLIHVDWMI----
  465 TLFDEN-----AASHIALGQAYS-TCLIG-GEKM-SNEELAKLGANESLIHVDWMI----
  466 TLFDEN-----SASHIAFGQCYS-KCLKK-PSNA-SCNWIEERGGNSSMTHIDWMI----
  467 TLFDEN-----AASHIAFGQCYS-KCFKK-PDNA-LDNWLEERGGNSSITHIDWMI----
  468 TLFDEN-----AASHIAFGQCYS-KCFKK-PDNA-LDNWLEERGGNSSITHIDWMI----
  469 ALYDEN-----AASHLALGASYD-ECLQN-GHHL-TPEQKRAAGANHSLIHIDWMI----
  470 TLYDEN-----AASHIAIGSAYR-FNVRG-GVDM-SLEEFNAAGGNDSLTHVDWMI----
  471 TLYDEN-----AASHIAIGSAYR-FNVRG-GVEM-STEDFAAKGGNDSLTHVDWMI----
  472 TLYDEN-----AASHIAIGSAYR-FNVRG-GVDM-TLEEFQAKGGNDSLTHVDWMI----
  473 TLYDEN-----AASHIAIGSAYR-FNVKG-GIDM-DAEQFAQKGGNDSLTHVDWMV----
  474 TLYDEN-----AASHIAIGAAYR-TNVRG-GEGM-TPEEFMAKGGNESLTHVDWMI----
  475 TLYDEN-----AASHIALGAAYR-FNVDG-GTTM-SDEEFAAHGGNDSIVHVDWMI----
  476 TLFDEN-----AASHLALGRAYR-FCVEG-GTTM-SDDEAQGVGLNDSLTHVDFMI----
  477 TLFDEN-----AASHIALGRCYP-TNVQG-GSD---EAVLHAAGGNDSLIHVDWMI----
  478 TLFDEN-----AASHIALGRCYP-TNVQH-GEN---PEALLAAGGNDSLIHVDWMI----
  479 TLFDEN-----AASHIALGRCYP-TNVQN-GEN---PEALRAAGGNDSLIHVDWMI----
  480 TLFDEN-----AASHIALGRCYP-TNVQG-GAD---AQQRQAAGGNDSLIHVDWMI----
  481 TLFDEN-----AASHIAMGRCYS-TNVQG-GSD---EQALTAAGGNRSLIHVDWMI----
  482 TLFDEN-----AAIHLALGRAYD-FNFER-G------KVRAEDGGNDSLIHVDWMI----
  483 TLYDEN-----ASSHLAFGRAYP-DTL---GLTEGDDAALTAAGGNASTVHLDWMI----
  484 TLLDEN-----AANHIAFGQSYS-ACIEA-GRDR------NIAGANTSALHIDCMI----
  485 NLFDEN-----ASSHLAIGQAYA-SGLKEDGANL--------ENINNSMIHIDFMI----
  486 ILFDEN-----AACHIAFGEAYP-ECIEG-GGAM-SKEELAARGANFSDTHVDFMI----
  487 TLIDEN-----ASCHFALGASYN-ECIEN-GLNM-SEEELLEHGMNQSFAHVDFMV----
  488 TLLDEN-----AASHLALGSAYL-MCLAD---------EADHERANRSAIHVDFMV----
  489 ILLDEN-----AASHVALGAAYS-VAVA----------AADAGRENSSAIHLDVVI----
  490 ILYDEN-----ASCHIALGNAYP-SCLSN-EQELKSDDAKLDYGCNVSLIHTDFMI----
  491 ILYDEN-----ASCHIALGNAYP-SCLSN-GQELKTDAEKLDYGCNVSLIHTDFMI----
  492 TLYDEN-----ASCHIALGSAYP-SCLSN-GSELKTDIAKLDYGCNVSLIHTDFMI----
  493 TLYDEN-----ASCHIALGSAYP-SCLSN-GSELKTDIAKLDYGCNVSLIHTDFMI----
  494 TLYDEN-----ASCHIALGSAYP-SCLSN-GSELKTDIAKLDYGCNVSLIHTDFMI----
  495 TLYDEN-----ASCHIALGAAYP-SCLSN-EGDLKTDTDKLNYGCNVSLIHTDLMI----
  496 TLYDEN-----ASCHIALGAAYP-SCLSN-EEDLKTDTDKLAYGCNVSLIHTDLMI----
  497 TLYDEN-----ASCHIALGAAYP-SCLSN-EEDLKTDTDKLNYGCNVSLIHTDLMI----
  498 TLYDEN-----ASCHIALGAAYP-SCLSN-EEDLKTDADKLTYGCNVSLIHTDLMI----
  499 TLYDEN-----ASCHIALGAAYP-SCLSN-EEDLKTDADKLTYGCNVSLIHTDLMI----
  500 TLYDEN-----ASCHIALGAAYP-SCLSN-EEDLKTDTDKLNYGCNVSLIHTDLMI----
  501 TLYDEN-----ASCHIALGAAYP-SCLSN-EEDLKTDTDKLNYGCNVSLIHTDLMI----
  502 ILYDEN-----ASCHIALGAGYP-SCLTD-SHNLTDADAKQAAGCNVSLVHTDFMI----
  503 ILLDEN-----ASCHIALGDAYP-SCLTN-GETLTTKEDLHKNGCNTSLMHVDFMV----
  504 ILLDEN-----ASCHLALGDGYP-TALAN-GSALSTDEQLHEAGCNTSLMHIDFMI----
  505 ILYDEN-----ASCHIALGAGYP-DCLEG-GRSLVTDKELHEHGCNTSLMHTDFMI----
  506 TILDEN-----AACHLALGCAYP-CSIHQ-KIKF-TKEEFEKAHLNYSTSHVDVIF----
  507 TLLDEN-----AACHLAIGCAYP-CSINH-KIEY-GRKEFERLGINYSNYHVDVMF----
  508 ILFDEKIG---GTIHLALGSAYP-ET----------------GGRNVSAIHWDMIKDMR-
  509 ILFDEKIG---GTIHLALGSAYP-ET----------------GGKNVSAIHWDMIKDMR-
  510 ILFDEKIG---GTIHLALGSAYP-ET----------------GGRNVSAIHWDMIKDMR-
  511 ILFDEKIG---GTIHMALGAAYP-ES----------------GGKNVSAIHWDMIKDMR-
  512 ILFDEKIG---GTIHMALGAAYP-ET----------------GGKNVSAIHWDMIKDMR-
  513 ILFDEKIG---GTIHMALGASYP-ET----------------GGKNVSSIHWDLIKDMS-
  514 ILFDEKIG---GTMHIALGASYP-ET----------------GGRNQSSIHWDMIRSLW-
  515 ILFDEKIG---GTIHMALGAAYL-QT----------------GGKNTSSIHWDIV-----
  516 ILFDEKIG---GTIHMALGSAYL-RT----------------GGVNRSSIHWDMIKDMR-
  517 ILFDEKIG---GTMHMALGAAYP-ST----------------GGRNQSAIHWDMVKDLR-
  518 ILFDEKIG---GTVHMAVGQTYM-QC----------------GGKNQSAIHWDMIAEMK-
  519 MLFDEKIG---GTIHLALGRSYP-ET----------------GGENISTIHWDMLCDMK-
  520 MLFDEKIG---GTIHFAIGSSYP-ET----------------GGKNVSSIHWDMLCDMK-
  521 ILFDEKIG---RSMHLAVGSSYP-EA----------------GGKNKSGLHWDLIKDMR-
  522 ILFDEKIG---KTMHLAVGSSYP-EA----------------GGKNKSGLHWDLIKRMN-
  523 ILFDEKIG---RTIHMAVGASYP-EA----------------GGKNKSGIHWDMIKGM--
  524 ILFDEKIG---RTIHMAVGASYP-EA----------------GGKNKSGIHWDMIKAM--
  525 ILFDEKIG---GSFHLACGAGYP-ET----------------GSVNKSAVHWDMVCDLR-
  526 ILFDEKIG---GSFHLACGAGYP-ET----------------GSVNKSAIHWDMVCDLR-
  527 ILFDEKIG---GSFHLACGAGYP-ET----------------GSINKSAVHWDMVCDLR-
  528 ILFDEKIG---GSFHLACGAGYP-ET----------------GSINKSAVHWDMVCDLR-
  529 ILFDEKIG---GSFHLACGAGYP-ET----------------GSINKSAVHWDMVCDLR-
  530 ILFDEKIG---GSFHLALGAGYP-ET----------------GSVNESAIHWDMVCDLR-
  531 ILFDEKIG---GTFHLALGNSYP-ET----------------GGRNQSTIHWDMICDLR-
  532 ILFDEKIG---GSFHMALGAGYP-ET----------------GSRNRSAIHWDMICDMR-
  533 ILFDEKMG---GTVHLALGACYP-ET----------------GGLNKSALHWDMICDLR-
  534 ILFDEKMG---GTIHMAVGASYP-ET----------------GGLNQSAIHWDMVCDLR-
  535 LLFDEKIG---GTVHLALGASYP-IT----------------GGRNQSAIHWDMICDLR-
  536 LLFDEKIG---GTVHLALGASYP-IT----------------GGKNRSAIHWDMICDLR-
  537 ILFDEKIG---GTVHLALGAGYP-ET----------------GSRNTSALHWDMICDMR-
  538 ILFDEKIG---GTVHLALGAGYP-ET----------------GSQNVSALHWDMICDMR-
  539 ILFDEKIG---GTLHLAIGAGYP-ET----------------GSRNRSAVHWDMICDLR-
  540 ILFDEKIG---GTLHLAIGAGYP-ET----------------GSRNRSAVHWDMICDLR-
  541 ILFDEKIG---GTIHMALGAGYP-DS----------------GSRNQSAIHWDLICDLR-
  542 ILFDEKIG---GTMHMALGRAYP-ET----------------GGTNASAIHWDMIADL--
  543 VLFDEKIG---GSVHLALGNSYP-ET----------------GGTNNSAVHWDLVLDLR-
  544 VLFDEKIG---GTVHFALGNAYP-ES----------------GGRNASAVHWDIVLDLR-
  545 VLLDEKMG---GTVHLALGRSYP-ET----------------GGRNESALHWDLVLSLR-
  546 ILLDEKMG---GTVHLALGRSYP-ET----------------GGRNESALHWDLVLSLK-
  547 ILLDEKMG---GTVHLALGRSYP-ET----------------GGKNPSALHWDLVLSLR-
  548 ILYDEKIG---GTVHLALGQSYP-ET----------------GGTNTSSIHWDLILDLR-
  549 ILFDEKIG---GTVHLALGRSYP-ET----------------GGVNESAVHWDLICDLR-
  550 VLLDEKIG---GTVHLALGQAYA-AT----------------GGTNRSAIHWDLIVDLR-
  551 ILFDEKIG---GTVHLALGRSYP-ET----------------GGVNGSAIHWDLITDLR-
  552 ILFDEKIG---GTVHLALGKSYP-ET----------------GGLNASAIHWDLITDLR-
  553 ILFDEKIG---GTVHLAIGKSYP-ET----------------GGLNRSAVHWDLITDLRA
  554 ILFDEKMG---GTVHLALGRSYP-ET----------------GGVNESGIHWDLITDLRP
  555 ILFDEKIG---GTVHLAVGKSYP-ET----------------GGVNASALHWDMICDLR-
  556 ILFDEKIG---GTVHLALGQAYE-ET----------------GGTNASAIHWDMICDLR-
  557 ILFDEKLG---GTVHLALGRSYE-AT----------------GGRNSSSIHWDLICDLR-
  558 ILYDEKIG---GTVHLALGQSYP-ET----------------GGVNESSLHWDLILDLR-
  559 ILYDEKIG---GTVHLALGQSYP-ET----------------GGINESTLHWDLIVDTR-
  560 TIFDEKMA---GTMHLALGRAYP-EC----------------GGKNESTLHWDLVCDL--
  561 ILFDEKFG---GTFHLALGKGYP-QT----------------GNTNASALHWDMIFDLR-
  562 MLFDEKMG---DTVHMAVGRAYD-ETVGED------------NEQNESAVHVDMIVDMS-
  563 MLFDEKMG---DTVHMAVGRSYD-ETVGED------------NEQNESAVHVDMIVDMS-
  564 MLFDEKMG---DTVHMAVGRAYD-DTVGED------------NEQNDSAVHVDMIVDMS-
  565 MLFDEKMG---DTVHMAVGRAYD-DTVGED------------NEQNDSAVHVDMIVDMS-
  566 MLFDEKMG---DTVHMAVGRAYD-DTVGEG------------NEANDSAVHVDMIVDMS-
  567 MLFDEKMG---DTVHMAVGRAYD-NTVGEG------------NEQNESATHVDMIVDMS-
  568 MLFDEKMG---DTVHMAVGMAYD-DCVGEG------------GEVNESAVHVDMIVDMG-
  569 MLFDEKMG---DTVHMAIGRAYD-ECVGED------------REANESAVHLDMIVDMS-
  570 MLFDEKMG---DTVHMAVGRAYE-DNVGEG------------NEQNESAQHVDMIVDMS-
  571 MLFDEKMG---DTVHMAVGRAYE-DNVGVG------------NEQNESAQHVDMIVDMS-
  572 MLFDEKMG---DTVHLAVGMAYD-ICVPDE------------REQNESAVHVDIIVDMS-
  573 MLFDEKMG---DTVHMAVGSAYP-ETVGEE------------NEENESAEHVDMILDMS-
  574 MLFDEKMG---DTVHMAVGSAYA-ETVGED------------NERNESAEHVDMIVDMS-
  575 MLFDEKMG---DTVHMAVGSAYP-ETVGAD------------NELNESAEHVDMIVDMS-
  576 MLFDEKMG---DTVHMAVGSAYP-ETVGEG------------NEVNESAEHVDMIVDMS-
  577 MLFDEKMD---ETVHMAVGSAYP-QCVGEG------------NEVNDSAEHVDMILDMS-
  578 MLFDEKMG---DTVHMALGRAYP-ETVGEG------------VEQNDSAKHVDMIVDMS-
  579 MLFDEKMG---DTVHMALGRAYP-ATVGEG------------VEQNDSAKHVDMIVDMS-
  580 MLFDEKMG---ETVHLALGRAYD-ANVGEG------------QTGNDSAVHVDMILDT--
  581 ILFDEKMA---ETFHLALGRAYD-ACLPAD------------EAGNDSAIHVDLIADTS-
  582 ILFDEKMA---ETVHLALGRAYD-ACLPEG------------ESGNDSAIHVDLIADTS-
  583 ILFDEKMG---GTVHLALGRAYD-ACVP--------------DGGNDSAIHVDLITDLR-
  584 ILFDEKMG---GTVHLALGRAYD-ACLPEG------------ESGNDSAVHEDLITTMG-
  585 ILFDEKMG---GTVHLALGRAYD-ACLPEG------------KSGNDSAVHEDLITTMG-
  586 ILFDEKMG---DTIHLALGRAYE-SNFPAGSE----------DEANESAVHVDMITDVS-
  587 ILFDEKMG---DTIHLALGRAYE-SNYPEGHE----------DEANDSAVHVDMITDMS-
  588 ILFDEKMG---DTIHLALGRAYD-ANLPDG------------ESGNDSAVHVDLITDVS-
  589 ILFDEKMG---DTVHLALGRAYD-ACLPDG------------EAGNDSSVHVDLITDVS-
  590 ILFDEKMG---ETVHLALGRAYD-ACLPEG------------ESGNESAVHVDMITDMS-
  591 ILFDEKMG---DTIHLALGRAYD-ACLPEG------------ETGNDSAVHVDMITDVS-
  592 IMFDEKMG---DTVHLAVGRAYD-ACLPEG------------ETGNDSAVHVDMITDVS-
  593 ILFDEKMG---DTIHLAVGRAYG-SCLPEG------------ESGNDSAVHVDMITDVS-
  594 ILFDEKMG---DTVHLAVGRAYG-ACLPEG------------EDGNQSAVHTDMITDMS-
  595 ILFDEKMG---DTVHLAVGRAYD-ACLPEG------------ETGNESAVHIDMITDMS-
  596 ILFDEKMG---DTVHFAVGRAYD-ACLPAN------------ESGNESAVHVDLITDIG-
  597 ILLDEKIY---GTIHIAMGRAYP-DV----------------GGTNQSAIHWDIIKDLR-
  598 ILLDEKMG---GTIHIALGRAYP-EC----------------GGTNQSAIHWDIVKDLR-
  599 LLIDEKIL---GTVHIAPGRAYP-EC----------------GGVNSSSLHWDIVKDLRG
  600 ILFDEKID---GSFHFTPGRCYD-EA----------------SNGNMSNIHWDMVMIQRP
  601 TLFDEKIN---GSFHFTPGKAYE-EC----------------NNGNKSAIHWDIVNIQRS
  602 ILFDEKIA---GSLHFTPGQAYE-ET----------------DNGNRSSIHWDLVLIQRP
  603 ILFDEKIA---GSLHFTPGQAYD-VT----------------DNGNRSSIHWDLVLIQRP
  604 TLFDEKID---GSLHFTPGQAYE-QA----------------DNGNRSSVHWDLVLIQRP
  605 ILFDEKID---GSLHFTPGQAYK-IA----------------DNSNRSSVHWDMVLIQRP
  606 ILFDEKIA---GSFHFTPGNAYT-VA----------------DNGNRSSVHWDLVQIQRP
  607 TLFDEKIA---GSIHFTPGSAYD-EC----------------FNGNKSAIHWDLVYIQTL
  608 TLFDEKIA---GSIHFTPGSAYD-HC----------------SNGNKSAIHWDLVYIQTP
  609 TLFDEKIA---GSFHFTPGSAYD-SC----------------FNGNKSAVHWDLVHVQTP
  610 TLFDEKIR---GSIHFTPGSCYD-EC----------------PNGNKSSIHWDLVFIQRP
  611 TLFDEKIK---GSFHFTPGNAYD-KT----------------FNGNRSAIHWDLVCIQNP
  612 TLFDEKIA---GSIHFTPGRAYE-EC----------------DNGNKSAIHWDLVYIQRP
  613 TLFDEKID---GSFHFTPGAAYE-EC----------------DNGNQSAIHWDLVCIQRP
  614 TLFDEKID---GSFHFTPGSCYD-EC----------------NNGNKSAVHWDLVCIQRA
  615 TLFDEKID---GSFHFTPGNCYD-DC----------------YNGNKSAIHWDLVCIQRP
  616 TLFDEKIM---GSFHFTPGNAYG-EA----------------DNGNRSSVHWDLVSIQRP
  617 ILFDEKID---GSFHFTPGQAYD-EA----------------FNGNKSSIHWDLVMIQRP
  618 ILFDEKID---GSFHFTPGQCYD-EA----------------YNGNKSSVHWDMVSIQRP
  619 ILFDEKID---GSFHFTPGQCYD-DA----------------FNGNHSTIHWDIVMIQRP
  620 ILFDEKID---GSFHFTPGQCYE-EA----------------SNGNQSSIHWDIVNIQRP
  621 ILFDEKID---GSFHFTPGQCYD-EA----------------YNGNSSNIHWDMVNIQRP
  622 ILFDEKID---GSFHFTPGQCYD-EA----------------YNGNHSNIHWDMVMIQRP
  623 ILFDEKID---GSFHFTPGECYE-DA----------------YNGNKSNIHWDMVMIQRP
  624 ILFDEKID---GSFHFTPGECYE-QA----------------YNGNHSNIHWDMVSIQRP
  625 ILFDEKID---GSFHFTPGQAYD-DA----------------WNGNNSNIHWDLVCIQRP
  626 ILFDEKID---GSFHFTPGQAYD-DA----------------WNGNNSNIHWDLVCIQRP
  627 ILFDEKID---GSFHFTPGQAYD-DA----------------WNGNNSNIHWDLVCIQRP
  628 ILFDEKID---GSFHFTPGQAYD-DA----------------WNGNNSNIHWDLVCIQRP
  629 ILFDEKID---GSFHFTPGQAYD-DA----------------WNGNNSNIHWDLVCIQRP
  630 ILFDEKIE---GSFHFTPGQCYD-EA----------------FNGNQSAIHWDLVNIQRA
  631 ILFDEKIE---GSFHFTPGQCYD-EA----------------FNGNQSAIHWDLVNIQRA
  632 ILFDEKIE---GSFHFTPGQCYD-EA----------------FNGNQSAIHWDLVNIQRA
  633 ILFDEKIE---GSFHFTPGQCYD-EA----------------FNGNQSAIHWDLVNIQRA
  634 ILFDEKIE---GSFHFTPGQCYD-EA----------------FNGNQSAIHWDLVNIQRA
  635 ILFDEKID---GSFHFTPGQAYA-EA----------------YNGNDSSIHWDLVNIQRP
  636 ILFDEKID---GSFHFTPGQAYD-EA----------------YNGNNSSVHWDLVNIQRP
  637 ILFDEKID---GSFHFTPGQAYE-NA----------------DNGNTSAIHWDIVNIQRP
  638 ILFDEKID---GSFHFTPGQAYD-NA----------------YNGNDSAVHWDIVNIQRP
  639 TLFDEKIQ---GSIHITPGRCYENDA----------------PNGNHSAIHWDLVLIQRP
  640 TLFDEKIA---GSIHFTPGNAYE-DA----------------DNGNRSAVHWDIVLIQTP
  641 TLFDEKIA---GSIHFTPGNAYE-DA----------------DNGNRSAVHWDIVLIQTP
  642 TLFDEKIA---GSIHFTPGSAYE-DA----------------DNGNRSAVHWDIVLIQTP
  643 TLFDEKIA---GSIHFTPGSAYE-DA----------------DNGNRSAVHWDIVLIQTP
  644 TLFDEKIA---GSIHFTPGSAYE-DA----------------DNGNRSAVHWDIVLIQTP
  645 TLFDEKIA---GSIHFTPGNAYE-DA----------------DNGNRSAVHWDIVLIQTP
  646 TLFDEKIA---GSIHFTPGSAYE-GA----------------DNGNRSAVHWDIVLIQTP
  647 TLFDEKIM---GSIHFTPGSSYD-EA----------------FNGNKSAVHWDLVLIQTP
  648 ILFDEKIM---GSFHFTPGACYD-DA----------------SNGNSSKIHWDLVCIQTK
  649 ILFDEKIM---GSFHFTPGACYD-EA----------------PNGNNSSVHWDLVCIQTK
  650 TLFDEKIT---GSIHFTPGNAYE-SC----------------DNGNRSAVHWDLVLIQRP
  651 TLFDEKIA---GSIHFTPGCCYE-DA----------------DNGNKSSLHWDLVLIQTE
  652 ILFDEKIA---GSIHFTPGMCYE-DA----------------PNGNKSAIHWDLVLIMRP
  653 ILFDEKIA---GSFHFTPGQAYE-EA----------------DNGNRSQVHWDMVQIQRP
  654 ILFDEKIA---GSFHFTPGQAYE-GF----------------GNGNKSQVHWDMVCIQRP
  655 ILFDEKIA---GSFHFTPGQAYA-DA----------------NNGNKSQIHWDMVCIQRP
  656 ILFDEKIN---GSFHFTPGQCYE-ET----------------ENGNRSQVHWDLVNIQRP
  657 ILFDEKIA---GSLHFTPGQAYE-VC----------------DNGNRSAVHWDMVLIQRP
  658 TLFDEKIG---GSLHFTPGNAYT-TA----------------DNGNRSSVHWDLVLGQTV
  659 TLFDEKIA---GSFHLTPGRAYD-QA----------------DNGNRSAIHWDLICIQRP
  660 ILFDEKIA---GSFHFTPGRAYD-NA----------------DNGNRSQIHWDMVNIQRP
  661 TLFDEKIA---GSFHFTPGNAYD-DC----------------DNGNRSAVHWDLVCIQRP
  662 TLFDEKIR---GSLHFTPGNAYD-DC----------------FNGNRSAVHWDLVQRQDA
  663 ILFDEKIS---GSFHLTPGQAYH-VA----------------DNGNQSRIHWDMVCIQTE
  664 ILFDEKIA---GSLHLAPGNAYD-EA----------------DNGNRSKVHWDLVLIQRP
  665 IGFDEKIN---GSLHLALGEAYE-VA----------------DNGNKSSIHWDIVLMLKP
  666 ILFDEKIF---GSIHLTPGQAYD-EC----------------DNGNRSAVHWDLVKVLT-
  667 ILFDEKIS---GSIHFTPGQAYD-EA----------------DNGNRSAVHWDMVRLM--
  668 ILFDEKIF---GSIHFTPGQCYD-EC----------------DNGNRSAVHWDMVKILN-
  669 ILFDEKIF---GSIHFTPGQCYD-EC----------------DNGNRSAVHWDMVKILT-
  670 ILFDEKIF---GSIHFTPGQCYD-EC----------------DNGNRSAVHWDMVKLLK-
  671 ILFDEKIF---GSIHFTPGQAYD-EC----------------DNGNRSAVHWDMVKILA-
  672 ILFDEKIF---GSIHFTPGQAYD-EC----------------DNGNRSAVHWDMVKILA-
  673 GLLVEKIG---GSFHLALGRPYS-YT------EY-QGVQVKVDNGGRSKLHWDITTMLYG
  674 TLFDENFGGPYGNCHVAVGASYA-DTYALGAGAL-DKAKKEAFGFNDSALHWDLV-----
  675 TLFDENFGGDNGNCHIALGASYA-DTFAEDSSQL-TPELKEEMGFNDSALHWDLV-----
  676 TLYDENFGGPHGNCHVAVGSSYS-DTFDGDPAGL-DGPRKEELGFNDSALHWDLV-----
  677 TLYDENFGGPHGNCHVAVGSSYS-DTFDGDPAGL-DGARKEELGFNDSALHWDLV-----
  678 TLYDENFGGPHGNCHVAVGSSYS-DTFDGDPASL-DGTRKEELGFNDSALHWDLV-----
  679 TLYDENFGGPNGNCHVAVGSSYS-DTYDGDPASL-DAARKAELGFNDSALHWDLV-----
  680 TLFDENFGGDQGNCHVAVGASYS-DTYAGDQSTL-DADKKRDLGFNDSALHWDLV-----
  681 TLFDENFGGPQGNCHVAVGASYA-DTFSGDQSTL-DEARKKELGFNDSALHWDLV-----
  682 TLYDENYGGEFGNCHVAVGSSYS-DTYAGDQTEL-NEQLKEELGYNTSALHWDLV-----
  683 TLFDENFGGEHGNCHVAVGASYA-DTYAGDPAEL-TDERKKELGFNDSALHWDLV-----
  684 TLYDENFGGQNGNCHVAVGSSYS-DTYAGDPAEL-TLERKEELGFNNSALHWDLI-----
  685 TLFDENYGGSFGNCHIALGSSYS-DTFSGNPKNL-TKEIKKNLGFNDSALHWDLV-----
  686 TLFDENFGGANGNCHVALGASYA-DTFAGNPAAL-TKTMKQQLGFNDSAIHWDIV-----
  687 TLFDENYGGKFGNCHVAIGASYA-DTYSGDAKEL-DAELKKKLGFNDSALHWDLV-----
  688 TLFDENYGGEYGNCHIALGSSYS-DTYSGNPAEL-DKKKKRVLGFNDSALHWDLI-----
  689 TLYDENHGGPHGSMHVALGQSYA-NTFSGPSDEL-TADARRDLGFNSSSLHWDLV-----
  690 TLYDENHGGPHGSMHVALGQSYA-NTFSGPSDEL-TSDARRDLGFNSSSLHWDLV-----
  691 TLFDENHGGENGSMHIALGQSYA-NTFAGAAPDF-DEATRERLGFNTSTLHWDMV-----
  692 TLYDENHGGRHGSMHIALGQSYS-NTFDGPPEDL-TPELRRSFGFNTSTLHWDMV-----
  693 TLYDENVGGEYGNTHIAVGSAYR-DSYTGDPSKV-GEKDWLEMGYNNSVVHTDIV-----
  694 ILEDEKVF---GTVHIALGSNYD------------------FGGKVKAPVHLDGII----
  695 ILQDEKI----PGIHIAFGNPYG----------------AHTGADWYSATHIDVVG----

                 39        40        
      EFGH234567890123456789012345678
                                     
                                     
    1 ----GTKDMKITGITEDGKEIPVFIDGSWAL
    2 ----GTKDMKITGITEDGKEIPVFIDGSWA-
    3 ----GTKDLSITGITKEGQKVCIFKNGNWA-
    4 ----GSKDLSIVGLDAEGNETPIFVDGNW--
    5 ----GTEDLSITGIQADGTQVPIFVNGDWAI
    6 ----GTRDLEILGTTYDGKEVSIFKNGNF--
    7 ----GTRDLKILGTTSDGSEIPIFKNGNFA-
    8 ----GTSDLEIIGKTSEGNSIPIFKNGNFAL
    9 ----GTNDLEIIGVTQEDKEIPVFQNGNF--
   10 ----GTADLEITGVTETGQQIPIFRNGNF--
   11 ----GTADLNITGVTAEGQEIPIFIQGNFVF
   12 ----GTADLNITGITAEGKEIPIFIQGNF--
   13 ----GTPDLKITGLTSAGQEIPVFIKGNF--
   14 ----GTEDLEITGTTAAGQEIPVFKNGNFSI
   15 ----GTKDLSITGITKDGKEIPVFINGNF--
   16 ----GTEDLNITGVTEDGREIPVFINGNFAY
   17 ----GTKDLQITGVTHDGEEIVIFKDGNF--
   18 ----GTKDLTIIGTTWDGEKIPVFTEGNWTF
   19 ----GTKDLKITGLTHDNVEIPVFKDGNWAF
   20 ----GTSDLEVIGIDHLGNETLIMKNGNFVF
   21 ----GTSDLEVIGIDHLGNETLIMKNGNF--
   22 ----GTSDLEIVGVDQFGNETIVMKNGNF--
   23 ----GTADMEIIGVDSEGIETLIMKDGNF--
   24 ----GSSDLDIIGENKKGEEIEIFKKGDWAF
   25 ----GSSDLDIIGENKKGEKIEIFQNGDWAF
   26 ----GSKDMNIVATKHDGTKVQIFKDGDW--
   27 ----GSEELEIIGETASGEKVQVFKNGDWVI
   28 ----GSEELEIIGETAEGEKIQVFKNGDW--
   29 ----GSRDLEIVGTRRDGTKVQVFHQGNF--
   30 ----GTRDLEIIGTTADGREIKIFEQGNF--
   31 ----GSRDLAIDGIEADGTRVPVFREGNFAF
   32 ----GTKDLTVVGRTSSGESVTIIEHGNF--
   33 ----GTADLTVIGQKPSGESVVIMENGNFTF
   34 ----GTADLSVVGRTRTGQEITIMEHGSFSF
   35 ----GTADLSVIGRTRAGEEITIMEHGSFSF
   36 ----GTADMSVIGRMRSGNSIPVIENGDF--
   37 ----GTADMSVIGRMRSGNSIPVIENGDF--
   38 ----GTEDLSVVGRTRDGRTIRVMEQGNF--
   39 ----GTEDLSVVGRTRDGRTIRVMEQGNF--
   40 ----GTKDTNITGITPAGEEIKIFNNGNW--
   41 ----GTKDTNIVGVKEDGTKISIFKDGNW--
   42 ----GTKDTSIIGIKEDGTEVQIFKDGNW--
   43 ----GTDDLDITGYTYDNTEIKIFDSGNW--
   44 ----GSSALDIKATTTAGESFYILKAGEW--
   45 ----GTQDLSIVGTTHDGEEIPVFVNGNFA-
   46 ----GSPGIDVDGETANGDREAIFRAGNW--
   47 ----GSEQLDIDGIREDGSVEPIFRKGNWAF
   48 ----GSGELDIDAEAADGTLTPIFRNGNW--
   49 ----GSAELDIDGITADGRHEPIFRKGNWAF
   50 ----GSAELDIDGITADGRHEPIFRKGNWAF
   51 ----GSAELDIDGITADGRHEPIFRKGNWAF
   52 ----GSAELDIDGITADGRHEPIFRKGNWAF
   53 ----GSAELDIDGITADGRHEPIFRKGNWAF
   54 ----GSAKLDIDGITADGRHEPIFRKGNWAF
   55 ----GSAELDIDGITADGRHEPIFRKGNWAF
   56 ----GSAELDIDGITADGRHEPIFRKGNW--
   57 ----GSAELDIDGITADGRHEPIFRKGNWAF
   58 ----GSAELDIDGITADGRHEPIFRKGNWAF
   59 ----GSAELDIDGITADGRHEPIFRKGNWAF
   60 ----GSAELDIDGITADGTHEPIFRKGNW--
   61 ----GSADLDIDGITADGKHEPIFRKGNWAF
   62 ----GSAEMDIDGIKADGTSEPVFRKGNWAF
   63 ----GSKDMNIDGITDDGKREPIFRNGNW--
   64 ----GSKDMNIDGITADGKREPIFRNGNWAF
   65 ----GSKDMSIDGITADGKREPVFRNGNW--
   66 ----GSKDMNIDGITADGKREPIFRNGNWAF
   67 ----GSKDMNIDGITADGKREPIFRNGNW--
   68 ----GSGEMNIDGITADGKREPIFRNGNWAI
   69 ----GSGEMNIDGITADGKREPIFRNGNWAI
   70 ----GSGEMNIDGITADGKREPIFRNGNWAI
   71 ----GSKEMNIDGITKDGKREPIFRNGNWAI
   72 ----GSAEMDIDGIKEDGQSEPVFRKGDWAF
   73 ----GSAEMDIDGITEDGNAEPVFRKGDW--
   74 ----GSAEMNIDGVTADGQIEPVFRNGDW--
   75 ----GSAEMDIDGITADGKSEPVFRRGGW--
   76 ----GSAEMNIDGITEDGKTEPVFRNGNWAF
   77 ----GSESMDIDGITKDGKTEPIFRNGNW--
   78 ----GSAEMNIDGETADGKREPLFRNGNWA-
   79 ----GSELMNIDGVTADGQSEPVFRNGNW--
   80 ----GSSEMDIDGILEDGSREPIFRGGNW--
   81 ----GSENMDIDGILPDGTVEPIFRKGNW--
   82 ----GSNKMNIDGITHDNQKEPIFRDGNWAF
   83 ----GSNKMNIDGITHDNQKDPIFRDGNWAF
   84 ----GSTEMNIDGITHDDQIDPIFRDGNW--
   85 ----GSAEMDIDGILKDGTVVPVFRNGNWAI
   86 ----GSAEMDIDGIQEDGTVVPVFRKGNWA-
   87 ----GSAEMDIDGIKADGTIVPIFRKGNWA-
   88 ----GSAEMDIDGILADGTSEPVFRKGNW--
   89 ----GSGDMDIYGVTADGKEEPVFLKGNW--
   90 ----GSGDMDIYGVTADGKEEPVFLKGNWAF
   91 ----GSGEMDIYGVTAEGKEEPVFLKGNW--
   92 ----GSAEMDIYGITEDGREEPVFLKGNW--
   93 ----GSGEMDINGVTEDGTEEPIFRKGNWAI
   94 ----GSAEMDINGVTEDGTEEPIFRKGNWA-
   95 ----GSAEMDINGVTEDGTEEPIFRKGNWAI
   96 ----GSAEMDIFGITADGKEEPIFIKGNWAF
   97 ----GSAEMDIDGITADGTTVPLFRKGNWA-
   98 ----GSKDLQITGITHDGKEEPVFIDGNWA-
   99 ----GSKELQITGITHDGKEEPVFIDGNW--
  100 ----GSKDLQITGITRDGREEPVFINGNW--
  101 ----GSKELNITGITHDGTEEPVFIDGNW--
  102 ----GSSDMDIDGITHDGERVPLFRQGNW--
  103 ----GSSDMNIDGIKKDGTREPVFRDGNWAF
  104 ----GSSEMDIDGITKDGKREPVFRKGNWAF
  105 ----GAADMDIDGVDKDGNRVPVFRNGDWA-
  106 ----GSGEMDIDGVKADGTTEPIFRNGEWA-
  107 ----GSGDMNIDGVKADGSTEPVFRNGEWA-
  108 ----GSSKMDIDGVTESGEVVPVFRNGDWAF
  109 ----GSSKMDIDGVTESGEVVPVFRNGDWAF
  110 ----GSSKMDIDGVTESGEVVPVFRNGDW--
  111 ----GSSEMDIDGVTESGEVVPVFRKGDW--
  112 ----GSSEMDIDGVTESGEVVPVFRKGDWAF
  113 ----GSSEMDIDGVTESGEVVPVFRKGDW--
  114 ----GSSEMDIDGVTESGEVVPVFRKGDWAF
  115 ----GSSEMDIDGVTESGEVVPVFRKGDWAF
  116 ----GSSEMDIDGVTESGEVVPVFRKGDW--
  117 ----GSAQMDIDGITQSGDSVPVFRNGDW--
  118 ----GSDKMNIDGITKSGETIPVFRNGDW--
  119 ----GSAEMNIDGEREDGTREAIMRDGNW--
  120 ----GSGQMSIDGELSDGTREPLMRDGNWA-
  121 ----GSADLNIDGVTKDGKREPIFRSGNWAF
  122 ----GSADLNIDGVTKDGKREPIFRSGNWAF
  123 ----GSADLNIDGVTKDGKREPIFRSGNWAF
  124 ----GSADLNIDGVTKDGKREPIFRSGNWAF
  125 ----GSADLNIDGVTKDGKREPIFRSGNWAF
  126 ----GSADLNIDGVTKDGKREPIFRSGNWAF
  127 ----GSAELNIDGVTKDGKREPIFRSGNWAF
  128 ----GSAELNIDGVTKDGKREPIFRSGNWAF
  129 ----GSAELNIDGVTKDGKREPIFRNGNWA-
  130 ----GSAELNIDGVTKDGKREPIFRNGNWAL
  131 ----GSAELNIDGVTKDGKREPIFRNGNWAF
  132 ----GSHELNVDGVTKDGVREPIMRNGEW--
  133 ----GSADMNIDGITQDGVREPVFRAGNWAL
  134 ----GSPELHIDGETKDGEFEPIFRNGNWAI
  135 ----GSENLDIDGVLEDGTTEAVFRNGTWAL
  136 ----GSEKLDIDGVKADGTTEAVFRNGTWAL
  137 ----GSEQMDIDGVKADGTTEPVFRNGTWAL
  138 ----GSDKLDIDGIMEDGTKEAVMRQGSWAI
  139 ----GSDELDIDGELPDGTVEPVFRRGCW--
  140 ----GSAEMDIDGITRDGKAEPVFRKGNWAF
  141 ----GSAELNLYGITEDGTREPILVNGNWAF
  142 ----GNGEMDIDGILPDGTVEPIFRKGSWAF
  143 ----GNGEMDIDGILPDGTIEPIFRKGSWAF
  144 ----GSGEMDIDGILPDGTVEPIFRKGSW--
  145 ----GSSEMDIDGILSDGTVEPIFRKGSWAF
  146 ----GSSEMDIDGILSDGTVEPIFRKGSW--
  147 ----GSSEMDIDGILPDGTVEPIFRKGSWAF
  148 ----GSSEMDIDGILPDGTVEPIFRKGSWAF
  149 ----GSSEMDIDGILPDGTVEPIFRKGSWAF
  150 ----GSSEMDIDGILPDGTVEPIFRKGSW--
  151 ----GSSEMDIDGILPDGTVEPIFRKGSWAF
  152 ----GSAEMDIDGILADGTTEPIFRKGNW--
  153 ----GSSSMDIDGIMADGSKEPIFRNGNW--
  154 ----GSAELDIDGELPDGTREPVFRQGNWAI
  155 ----GSADLDIDGELADGTIEPIFRKGNWV-
  156 ----GSAELDIDGVLADGTIEPVFRGGRW--
  157 ----GSAELDIDGVLADGTIEPVFRGGRW--
  158 ----GSAELDIDGELADGTVEPVFRGGRW--
  159 ----GSAELDIDGVLEDGTIEPVFRGGRW--
  160 ----GSAELDIDGELQDGSKEAVFRKGNWAI
  161 ----GSAELDIDGELQDGSTEAVFRKGNWAI
  162 ----GSAELDIDGELQDGSKEAVFRKGNWAI
  163 ----GSAELDIDGELQDGSKEAVFRKGNWAI
  164 ----GSADMDIIGETYDGKQIQIFKNGNWAF
  165 ----GSADLDIVGITHDGEEIQIFKDGNW--
  166 ----GSADMDITGITKNGEEIAIFKNGNWAF
  167 ----GDKDMDIVGIKQDGTEFAIFKDGNWAF
  168 ----GDKDLDIVGVQEDGQEFQIFKDGNW--
  169 ----GSDQLDIDGENQEGEWEPVFRNGEW--
  170 ----GSGELDIDGITQDGRRVPVFRKGAW--
  171 ----GSAQMSIDGIKEDGTTVPVFRNGDW--
  172 ----GSAQMSIDGIKEDGTTVPVFRNGDW--
  173 ----GSDQMSIDGIKEDGTTVPVFRNGDW--
  174 ----GSDKMNIDGIKEDGTIVPVFRNGDW--
  175 ----GSDKMNIDGIKEDGTIVPVFRNGDW--
  176 ----GSDKMNIDGIKEDGTIVPVFRNGDW--
  177 ----GSDKMNIDGIKEDGTIVPVFRNGDW--
  178 ----GSDKMNIDGIKEDGTIVPVFRNGDW--
  179 ----GSDKMDIDGIREDGSTVPIFRNGDWA-
  180 ----GSNQMSIDGIKADGTVVPVFRNGDWA-
  181 ----GSSHMNIDGIKKDGSRVPIFRNGEW--
  182 ----GSDKMDVDGIRKDGSTVPVFRNGDWA-
  183 ----GSDKMDVDGIRADGSTVPVFRNGDWA-
  184 ----GSADMDIDGIKADGTRVPIFRNGTW--
  185 ----GSNQMDIDGIREDGTRVPLFRNGDW--
  186 ----GSNQMDIDGIREDGTRVPLFRNGDW--
  187 ----GSSQMDIDGIREDGTRVPLFRNGDWA-
  188 ----GSNQMDIDGIREDGTRVPLFRNGDWAI
  189 ----GSNQMDIDGIREDGTRVPLFRNGDW--
  190 ----GSNQMDIDGIREDGTRVPLFRNGNW--
  191 ----GSNQMDIDGIREDGTRVPLFRNGDW--
  192 ----GSNQMDIDGIREDGTRVPLFRNGNWA-
  193 ----GSSQMDIDGIREDGTRVPLFRNGDWAI
  194 ----GSNQMDIDGIREDGTRVPLFRNGDWAI
  195 -------------------------------
  196 ----GSNQMDIDGIREDGTRVPLFRNGNWAN
  197 ----GSNQMDIDGIREDGTRVPIFRNGDWAI
  198 ----GSNQMDIDGIREDGTRVPLFRNGDWAI
  199 ----GSNQMDIDGIREDGTRVPLFRNGDWAI
  200 ----GSSQMDIDGIREDGTRVPLFRNGDW--
  201 ----GSNQMDIDGIREDGTRVPLFRNGDW--
  202 ----GSSQMDIDGIREDGTRVPVFRNGDWAI
  203 ----GSSQMDIDGIREDGTRVPVFRNGDWAI
  204 ----GSSQMDIDGIREDGTRVPVFRNGDWAI
  205 ----GSSQMDIDGIREDGTRVPLFRNGDWAI
  206 ----GSDQMDIDGIREDGSRVAIFRNGDWA-
  207 ----GSNQMDIDGIREDGSRVAIFRNGDWA-
  208 ----GSNQMDIDGIREDGSRVAIFRNGDWAI
  209 ----GSNQMNVDGIREDGSRVAIFRNGDWAI
  210 ----GSNQMDIDGIREDGSRVPIFRNGDWAI
  211 ----GSSQMDIDGIREDGSRVPIFRNGDWAI
  212 ----GSNQMDIDGIRQDGSRVPIFRNGDWVI
  213 ----GSNQMDIDGIRQDGSRVPIFRNGDWVI
  214 ----GSNQMDIDGIRQDGSRVPIFRNGDWVI
  215 ----GSNQMNIDGIHHDGSRVPIFRK-----
  216 ----GSNQMNIDGIHHDGSRVPIFRNGDWVI
  217 ----GSNKMNIDGIREDGTRVPIFRDGEWAI
  218 ----GGPEMNVDGIREDGTVVPIFRNGDWAI
  219 ----GGPNMNVDGIREDGTVVPIFRNGDWAI
  220 ----GSADMNIDGIKQDGTVVPVFRNGDWA-
  221 ----GSDKMDIDGITKDGQVVPIFRGGEWAI
  222 ----GSDKMDIDGITKDGKVVPIFRSGEWAI
  223 ----GSEKMDIDGITKDGQVIPIFRGGEWAI
  224 ----GSEKMDIDGITKDGQVIPIFRGGEWA-
  225 ----GSEHMDIDGITKDGQIVPIFRGGEWAI
  226 ----GSENMDIDGITKNGKVVPIFRGGEWAL
  227 ----GSDQMDIDGITADGQIVPIFRSGEWA-
  228 ----GSEQMDIDGITKDGEVIPIFRGGEWA-
  229 ----GSDQMDIDGITKDGQVIPIFRKGEWAI
  230 ----GSEQMDIDGIRADGTAVPIFRNGEWAI
  231 ----GNAEMNVDGITEDGQRIPIFRNGEWAI
  232 ----GNGQMDIDGIKADGSVHPIFRNGEW--
  233 ----GNEHMDIDGIKADGTRVPIFRKGEW--
  234 ----GSAEMDIDGIDADGNVFPIFRQGEW--
  235 ----GSADMDIDGIKEDGTVIPIFRNGDW--
  236 ----GSADMDIDGIKEDGTVIPIFRKGDW--
  237 ----GSADMNIDGIRADGTKAPIFRNGDW--
  238 ----GSADMDIDGIKKNGTIVPVFRNGDWA-
  239 ----GSDDMNIDGVKADGTVVPVFRNGDW--
  240 ----GSSEMNIDGIKEDGTVVPVFRNGNWA-
  241 ----GSAAMNIDGIKPDGTIIPIFRNGDWA-
  242 ----GSANMNIDGIKPDGTVVPIFRNGDW--
  243 ----GSADMNIDGIKADGTVVPIFRNGDW--
  244 ----GSADMNIDGIKADGTVVPIFRNGDW--
  245 ----GSADMNIDGIKADGTVVPIFRNGDWA-
  246 ----GSSQMNIDGLTHDGQIVPIFRNGDW--
  247 ----GSSDMNIDGLTHDGQIVPVFRNGDWAN
  248 ----GAPDMAIDAYTKDDRLIPIFRNGNWV-
  249 ----GSADMTIDGVTQDGQLVPVFRQGNW--
  250 ----GSADMDIDGVTQDGQLVPVFRQGNW--
  251 ----GSADMDIDGITYDGQVIPVFRNGDW--
  252 ----GSADMNVVGIKYDGTITPIFENGDW--
  253 ----GSADMNIDGITQDGQTVPVFRNGDW--
  254 ----GSADMNIDGITQDGQTVPVFRNGDW--
  255 ----GSADMSIDGITQDGQIVPVFRNGDW--
  256 ----GSSDMMIDGVTHDGTVVPVFRSGDWA-
  257 ----GSSDMMIDGVTHDGTVVPVFRSGDW--
  258 ----GSNDMDIDGVTQDGEVVPVFRSGDW--
  259 ----GSSDMMIDGITQDNHSVPVFRNGDWA-
  260 ----GSADMDIDGITQDGQLVPVFRQGDW--
  261 ----GSSDMAIDGVTQDDRIIPVFRNGDW--
  262 ----GSKQMNIDGIKKDGTVVPIFRDGNW--
  263 ----GSDQMHIDGIKPDGSIVPVFRNGNWA-
  264 ----GDAEMDIDGILEDGTRVPVFRKGNW--
  265 ----GDAEMDIDGILEDGTKIPVFRKGNWA-
  266 ----GDAEMDIDGINEDGTREPVFRKGNW--
  267 ----GSAQMNIYGVTSEGNEEEIFLNGNWA-
  268 ----GSSDLTIYGILHDGTKELVFENGNWAK
  269 ----GSSDLTIYGILHDGTKELVFENGNW--
  270 ----GSSDLTIYGILQDGTKELVFENGNW--
  271 ----GSPDLTIYGILQDETKELVFKNGNW--
  272 ----GSPDLTIYGILQDETKELVFKNGNWAK
  273 ----GSPDLTIYGILQDETKELVFKNGNWAK
  274 ----GSSDLTIYGILQDGSKELVFENGNW--
  275 ----GSADLTIYGILEDGSKELVFENGNW--
  276 ----GSADLTIYGILEDGTKELVFENGNW--
  277 ----GSADLTIYGIKQDDTKELVFKNGNWAQ
  278 ----GSSDLTIYGIFEDGSKELVFENGNWAS
  279 ----GSSDLTIYGIFEDGSKELVFENGNW--
  280 ----GSSDLTIYGIFEDGSKELVFENGNW--
  281 ----GSSDLTIYGIFEDGSKELVFENGNW--
  282 ----GSSDLTIYGILEDGTEELVFENGNWA-
  283 ----GSSDLTIYGILEDGSKELVFKNGNWA-
  284 ----GSSDLNIYGILEDGREELVFKDGNW--
  285 ----GSPDLTIYGITQNGEKELVFEQGNWAK
  286 ----GSPDLTIYGITQDDEKELVFENGNWSK
  287 ----GSPDLRITGITQDDEEVPVFENGNW--
  288 ----GSSDLTIYGITQDGKEEIVFKDGNWA-
  289 ----GSSDLNIYGVLEDGTKEQIFKDGNWS-
  290 ----GTKDLNIVGKKYDGTEVPVFKDGNW--
  291 ----GTPDLDIIGIKKDGTEIQIFKNGNW--
  292 ----GTPDLDIIGIKKDGTEIQIFKNGNW--
  293 ----GSKDMRIVGTTADGKEIEVFKEGNWAI
  294 ----GSKDMRIVGTTADGKEIEVFKEGNWAI
  295 ----GSEDMRIVGTTADGKEVEVFKEGNWAI
  296 ----GDETLNVVGI-----------------
  297 ----GDETLNIIGITESGEEIPVFTNGNW--
  298 ----GDETLNIVGITESGEEVPVFTNGNWS-
  299 ----GSKDLSIIGMTKDGKEVQIFENGNF--
  300 ----GDSTTNIVGISKSGERIQIFKDGNFVI
  301 ----GDATTDITAHKGD-EVVQIFKDGNFVI
  302 ----GDATTSIVGIKEDGTEMQIFKDGDFVI
  303 ----GDESTQITGQRWDGTIVKIFENGNFAI
  304 ----GDESTQITGQRWDGTIVKIFEDGNFA-
  305 ----GDETTEIIGVKENGDQVQIFKEGNFVI
  306 ----GEATTNIVGITADGKEVAIFKDGNW--
  307 ----GEATTNITGYTADGKEVAIFKDGNW--
  308 ----GEGTTNIVGITKDGREVQIFKDGNW--
  309 ----GTEDLEITGY-KDDKEFKIFEKGNWA-
  310 ----GTSDLEITGY-KNEEEFKIFEKGNWA-
  311 ----GDKDLEIIGY-KNEKAYPIFKDGNWA-
  312 ----GAKDLNIKAY-KDGEEFDVFVDGNWA-
  313 ----GAKDLNIKAY-KDGEEFDVFVDGNWA-
  314 ----GAKDLSIKAY-KDGEEFDVFVDGNW--
  315 ----GSADLDIDAVLKDGRTVPIFRKGRW--
  316 ----GSDRMDIDAETRSGETVPIFRSGRWA-
  317 ----GSPDMKITGVCEDGCEVAVFEQGNFVF
  318 ----GSPDMKITGVCEDGCEVAVFEQGNFVF
  319 ----GSPDMKITGVCEDGCEVAVFEQGNF--
  320 ----GSPDMKITGVCEDGCEVAVFEQGNFVF
  321 ----GSADMKITGVCDDGREVSVFEKGNFVF
  322 ----GNDDMSIDGIKDDGSCVPVFRKGNFVF
  323 ----GNDDMSIDGIKDDGSCVPVFRKGNFVF
  324 ----GTADMKVVGTLHDGKKVTIFENGNF--
  325 ----GSDDMQITGVHADGSEVVFFHDGQF--
  326 ----GTKEMNIDGIQQDGTVVPVFRNGNFVI
  327 ----GTKEMKVDGIQKDGTVVPVFRKGNFVI
  328 ----GSEDMSVVGTTHDGKTIIVFNEGNF--
  329 ----GSKDLKIVGTKQDGTKVVVFEDGNF--
  330 ----GNENMNVYGI-KAGEKITLMESG----
  331 ----GNEEINVWGV-KGNEKIKLMEKGLF--
  332 ----GNEELDVYGI-KDGKEELIMKNG----
  333 ----GNDKMNVYGI-KDGKEYLLMENGLW--
  334 ----GNDKMNVYGI-KEGKKEIIIENGLW--
  335 ----GNDKLSIIGETESGEKISIFKNGEW--
  336 ----GSADMIIEGLCEDGKIVPIFINGNW--
  337 ----GSEDLAVTGIKEDGTKVPVFINGSW--
  338 ----GSPDLTITGIRKDGTKVSVFVNGDWA-
  339 ----GSPDLTITGTKADGTTVPVFTHGDWA-
  340 ----GSEDLQITGRTADNKEIPIFTNGDW--
  341 ----GSEDLQITGRTADNKEIPIFTNGDWS-
  342 ----GDEHMNIKGYTRDGQEVDIMIDG----
  343 ----GHEHMNIKGYTRDGQAVDIMIDG----
  344 ----GHERMNIKGYTRDGQEVEIMIDGR---
  345 ----GHEHMNIKGYTRDGQEVDIMIDG----
  346 ----GHEHMNIKGYTRDGQEVDIMIDG----
  347 ----GHEHMNIKGYTRDGQEVDIMIDG----
  348 ----GHENMNIKGITKDGQQVDIMIDG----
  349 ----GHEKMNIMGTTKDGKEVPIMIEGR---
  350 ----GGPELSVIGVKKDGTEIPILQKGNWVI
  351 ----GGPELSVIGVKKDGTQVQILKNGNWAI
  352 ----GGPELSIVAYEKDGTEVELFKNGNW--
  353 ----GAEDSRITGKCRDGRTVPLFENGVWVL
  354 ----GAPDMTITGTTRTGENVKIFENGEW--
  355 ----GAADSQITGITKSGEEVTIFTDGEW--
  356 ----GSEEMDVDGLYEDGTRTPLMRRGRWVV
  357 ----GSEEMDVDGLYEDGTRTPLMRRGRWVV
  358 ----GSEEMDVDGLYEDGTRTPLMRRGRWVV
  359 ----GSGEMEVDGLLEDGTRVPLMRQGRFVI
  360 ----GSEEVDVDGLLEDGTRVPLMRRGRWVI
  361 ----GSMEMQVDGILQDGTRVPLMREGLWVI
  362 ----GSALMDVDGVNADGTITPVMRGGAFVI
  363 ----GSALMDVDGVNADGTITPVMRGGAFVI
  364 ----GSNEIDVDGITHTGQAEPLMRRGEW--
  365 ----GSSEIDVDGITASGQAEPLMRKGEW--
  366 ----GSGEIDIDGIAADGTQEAVMRRGEWA-
  367 ----GSGEVDVDGITASGEAEPVMRRGEWA-
  368 ----GSADVDVDGVTAEGAFEPVMRRGEW--
  369 ----GSAAVDVDGLTAEGGAEPVMRRGEW--
  370 ----GSAEIDVDGITASGEALPVMRRGEWA-
  371 ----GSAEIDVDGITASGEALPVMRCGEW--
  372 ----GSAEIDVDGITASGEALPVMRRGEWAD
  373 ----GSAEIDVDGITDSGEAVPVMRRGEWA-
  374 ----GSGETDIDGISSDGSRV----------
  375 ----GSAETDIDGISGDGSRVP---------
  376 ----GSGEIDIDGIGSDGSRV----------
  377 ----GSGEIDIDGIGADGSR-----------
  378 ----GAAETNIDGLHADGRRVPVFRKGEW--
  379 ----GAAETNIDGLHEDGRRVPVFRNGEWA-
  380 ----GAAETDIDGVHADGRRVPVFRKGEW--
  381 ----GAAETDIDGIHADGRRVPVFRKGEWA-
  382 ----GAAETDIDGVHEDGRRVPVFRKGEW--
  383 ----GAADTDIDGICADGSRVPVFRKGEW--
  384 ----GSAETDIDGILADGSKVPVFRKGEWAK
  385 ----GSSETDIDGILADGSKVPVFRKGEW--
  386 ----GSAETDIDGILADGSKVPVFRKGEW--
  387 ----GSAETDIDGILADGSKVPVFRKGEW--
  388 ----GSDKIDIDGVHKDGARVPVMRKGEWA-
  389 ----GSDKIDIDGVHKDGARVPVMRKGEWA-
  390 ----GSDKIDIDGVAKDGSRVPVMRKGEW--
  391 ----GSDKIDIDGVHKDGSRVPVMRKGEWA-
  392 ----GSDKIDIDGVAKDGSRVPVMRKGEW--
  393 ----GSAHTDVDGIRSDGSRVAVFRQGEWA-
  394 ----GSDKVDIDGVKPDGSRVAVMRQGEW--
  395 ----GSDKVDIDGVKPDGSRVAVMRQGEW--
  396 ----GSNKVDIDGLKPDGSRVPVMRQGEWA-
  397 ----GSDKVDIDGIKPDGSSVPVMRKGEWA-
  398 ----GSGEVDIDGVRADGGRVPVMRKGEWA-
  399 ----GSGEVDIDGVRADGARVPVMRKGEWA-
  400 ----GSGAVDIDGVRADGSRVPVMRQGEWA-
  401 ----GSGEVDIDGVRADGSRVPVMRKGEW--
  402 ----GSDKVDIDGVKADGTTVPVMRKGEWA-
  403 ----GSDKVDIDGVSADGSKVPVMRRGEW--
  404 ----GSNKVDIDGVKPDGSTVPVMRKGEW--
  405 ----GSNKVDIDGVKPDGSTVPVMRKGEWA-
  406 ----GSDKVDIDGVKPDGSTVPVMRKGEWA-
  407 ----GSDKVDIDGVKPDGSTVPVMRKGEWA-
  408 ----GSGQINVDGINADGTREPVMRGGEW--
  409 ----GSGQIDVDGINADGTREPVMRSGEWAN
  410 ----GSGEIDVDGINADGSREPVMRKGEWAS
  411 ----GSGEIDVDGINADGSREPVMRKGEWAS
  412 ----GSGEIDVDGINADGSREPVMRKGEWAS
  413 ----GSGEIDVDGINADGSREPVMRKGEWAS
  414 ----GSGEIDVDGINADGSREPVMRKGEW--
  415 ----GSGEIDVDGINADGSREPVMRKGEW--
  416 ----GSGEIDVDGINADGSREPVMRKGEWAS
  417 ----GSGEIDVDGINADGSREPVMRKGEWAS
  418 ----GSGEIDVDGINADGSREPVMRKGEWAS
  419 ----GSGEIDVDGINADGSREPVMRKGEW--
  420 ----GSGEIDVDGINADGSREPVMRKGEW--
  421 ----GSGEIDVDGINADGSREPVMRKGEW--
  422 ----GSGEIDVDGINADGSREPVMRKGEW--
  423 ----GSGEIDVDGINADGSREPVMRKGEWAS
  424 ----GSGEIDVDGINADGSREPVMRKGEW--
  425 ----GSGEIDVDGINADGSREPVMRKGEW--
  426 ----GSGEIDVDGINADGSREPVMRKGEW--
  427 ----GSGEIDVDGVNADGSREPVMRKGEW--
  428 ----GSGEIDVDGVNADGSREPVMRKGEW--
  429 ----GSGEVDIDGVAADGTRTAVFRRGEWAL
  430 ----GSGEMDIDGITQDGERVPVFRKGEWA-
  431 ----GSNEINIDGVMQDGTKIPVFRQGEW--
  432 ----GSNEINIDGVMQDGAKIPVFRQGEW--
  433 ----GSNEINIDGVRQNGAKIPVFRQGEW--
  434 ----GSNEINIDGIMQDGAKIPVFRRGEW--
  435 ----GSGEIDIDGITQAGTRVPVFRRGEWA-
  436 ----GSGEIDIDGITQDGVRVPVFRKGEWA-
  437 ----GSGEIDIDGITQAGVRVPVFRKGEWA-
  438 ----GSDEIDIDGITQDGMRVPVFRKGEWA-
  439 ----GSGEIDIDGITQEGMRVPVFRKGEWA-
  440 ----GGADTDIDGITPDGTRVPVFRGGEW--
  441 ----GGADTDIDGITPDGTRVPVFRGGEWA-
  442 ----GGPDTDIDGIAADGTATPVFRKGEW--
  443 ----GGAETDIDGLREDGTRVPVFRQGEWA-
  444 ----GSAEVDVDGLDAAGNVTPVMRKGEWAL
  445 ----GSAEVDVDGIRFDGGREPVMRKGEWV-
  446 ----GSDAVDIDGITKTGDRVPVMRGGEWA-
  447 ----GSDAVDIDGITKTGEVIPVMRKGEWA-
  448 ----GSSKIDVDAVNHDGTREPLMRQGEW--
  449 ----GSSKIDVDAINHDGTREPLMRQGEW--
  450 ----GSSKIDVDAINHDGTREPLMRQGEW--
  451 ----GSGKIDVDAINHDGTREPLMRQGEW--
  452 ----GSNQIDVDAITHDGTRESLMKQGEWT-
  453 ----GSAEIDVTAITQDGAREPLMKHGEWV-
  454 ----GSDKIDLDGL-KNGNRVPLMRAGEWVQ
  455 ----GSDRIDLDGI-KDGQKTPLMRAGEWV-
  456 ----GSGEIDVDGVDAKGERVALMRKGEWVI
  457 ----GSGDIDVDGVDAKGERVALMRKGEWVI
  458 ----GSGEIDVDGMDAKGERVALMRKGEWVI
  459 ----GSGEIDVDGLDAQGGRVPLMRKGEWVI
  460 ----GSDAMNIDGINKDGNITPVFRNGDW--
  461 ----GSGEVSVDGVNADGSHEPLMVKGEF--
  462 ----GSNKLDIDGITADGTAEPVMRQGEW--
  463 ----GSAQMDVDGIAHDGTSEPLMRQGEW--
  464 ----GGGTMDVDGLDADGKAEPLMRQGEW--
  465 ----GGPTMNVDGLAADGSAEPLMRAGDW--
  466 ----GSGDINVDGLTKSGVLVPIMREGEW--
  467 ----GSGDMNVDGLTKNGVLVPIMRGGEWA-
  468 ----GSGDMNVDGLTKNGVLVPIMRGGEW--
  469 ----GSEQVDVDGITPSGGVEPLMRRGEW--
  470 ----GSSEMNVDGLTRDGSREPVMRNGEFVI
  471 ----GSGEMDVDGVTKDGAREPVMRAGEFVV
  472 ----GSGEMDVDGITRDGQREPVMRAGEFVI
  473 ----GSDQIDVDGITKDGNREPVMRAGEFVI
  474 ----GSAEMDVDGILRDGSHEPVMRAGEFVL
  475 ----GSAAMDVDGVTKDGGREPVMRAGEFVI
  476 ----GSSEMDVDGVREDGAEEPVMRAGEWA-
  477 ----GTPGTDVDGITKDGAREPLMRNGEWVV
  478 ----GTPGTDVDGVTATGDREPLMRGGEWVI
  479 ----GTPDMDVDGITADGKCEALMRGGEWVV
  480 ----GTPGASVDGITADGQREPLMRGGEWMI
  481 ----GSPTTDVDGLTRDGNRIPLMRQGEWVV
  482 ----GSAQVDVDGVRADGEREPVMRGGEW--
  483 ----GSPEVDVWGERADGTRVPLLERGRWV-
  484 ----GHDAMDVDGVLKSGERRAIMRAGDFVL
  485 ----GSQKLQVNGIREDGTAEAILVNGKWVI
  486 ----GTATMHIDGLCADGRTVTIMRDGRF--
  487 ----GTSDLSIEATLKNGEKIFIFKNGKY--
  488 ----GSPDVSAIGVAADGSETPVLVQGAW--
  489 ----GGPAVDVDGVEPGGARVPLLRAGAWA-
  490 ----GSNDINVIGIDKSDKEHTIIRNGQFVI
  491 ----GSNDINVIGIDKSRKEHTIIQNGQFVI
  492 ----GSNDINVIGIAKSGKEHIIIQNGQFLI
  493 ----GSNDINVIGIAKSGKEHIIIQNGQFLI
  494 ----GSNDINVIGIAKSGKEHIIIQNGQFLI
  495 ----GSDDLDVIGVGKNGKEYIIIKAGKFAI
  496 ----GSDDLDVIGVDKNGKEYTIIKAGKFAI
  497 ----GSDDLDVIGVDKNGKEYAIIRAGKFAI
  498 ----GSDDLNVIGVDKNGKEYTIIKAGKFAI
  499 ----GSDDLNVIGVDKNGKEYTIIKAGKFAI
  500 ----GSDDLNVIGVDKNGKEYTIIKAGKFAI
  501 ----GSDDLNVIGVDKNGKEYTIIKAGKFAI
  502 ----GSPETDVTGIDRDGHEHALIRSGKFVI
  503 ----GSKQMQITAKTREGEEVELMRNGV---
  504 ----GSKDMDIDATTFDKRSFAVMRKGVF--
  505 ----GSKETDVTAITRAGKEVPVIKKGHF--
  506 ----GDLSITIIAHTKNGEVIPLMQDGKWS-
  507 ----GDSRVTITASSNNNEEILLMENGEW--
  508 ----N-AKVYVDNEL-------IYENGRF-I
  509 ----N-AKVYVDNEL-------IYENGRFII
  510 ----G-SKIYVDGDL-------VYENGRF-V
  511 ----K-HKVYADGDL-------IYENGYFIK
  512 ----K-HRIYADGDL-------IYENGYFIK
  513 ----K-GKVYADGVL-------IYEKGRF-I
  514 ----S-HKVYADGDL-------IYENGRFIK
  515 -------------------------------
  516 ----K-GRVYADKDL-------IYIDGKFIE
  517 ----RESRVYADGDL-------IFENGRFIE
  518 ----NGGEIWADG------------------
  519 ----NGGEIYADGEL-------IYQAGE---
  520 ----KNGRIYADGEL-------FYENGE---
  521 ----EDAVVYADGKK-------IYENGKF--
  522 ----NGGEVYVDGEL-------VYKDGKF--
  523 ----ADGKVYADGVM-------IYSEGRF--
  524 ----EDGKAYLDGRL-------VFENGRF--
  525 ----DGGEIWVDGEL-------LYKNGEFII
  526 ----DGGEIWVDGEL-------LYKNGKFVI
  527 ----DGGEIWVDGEL-------LYKNGKFVI
  528 ----DGGEIWVDSEL-------LYKNGKFVI
  529 ----DGGEIWVDGEL-------LYKNGKFVI
  530 ----NGGQITVDGEL-------LYRDGNFTI
  531 ----TDSEILVDGEV-------VYRNGTFLI
  532 ----TDSEILVDGEL----------------
  533 ----QQGEVWVDDTL-------FLKDG----
  534 ----QNSEVYVDGQL-------FQKNG----
  535 ----QGGEIYADGEL-------IYRDGK---
  536 ----QGGEIYADGEL-------IYREGR---
  537 ----Q-GEAYADGRL-------IYKEGK---
  538 ----Q-GEAYADGRL-------IYKDGK---
  539 ----RDSEVWVDGQL-------FMKDG----
  540 ----HQSEVWIDGQL-------FMKDG----
  541 ----QGGQVTVDGEV-------FLKDG----
  542 ----TDAKVYADGEL-------IYENRK---
  543 ----AGGRIWADGEV-------LQENGQFV-
  544 ----SGGKILVDGAV-------LQEDGRFV-
  545 ----E-GRLLLDGTP-------LLEAGRFL-
  546 ----E-GRLLLDGEP-------LMVEGRFV-
  547 ----E-GSLLLDGEP-------LVEQGRFV-
  548 ----RGGRLLADGEV-------LQEDGRFV-
  549 ----RGGRLTADGVV-------IQENGRF--
  550 ----RGGALIADGEV-------VQEDGRF--
  551 ----GQGRLSLDGEV-------VQEGGHFV-
  552 ----QGGRLSLDGEV-------VQENGIFL-
  553 ASGAGGGRLLLDGEV-------WQEGGRFLS
  554 AA--GGGTVSLDGEV-------WQQGGQFV-
  555 ----SGGQILLDGEV-------FQENGRFV-
  556 ----QGGAIYLDGEL-------FQENGVF--
  557 ----GGGEIRADGEL-------VQKDGRFV-
  558 ----SKGRITVDDRV-------VMENGRW--
  559 ----TGGRVTADGRV-------VMENGT---
  560 ----HQAEVYANNAL-------CYKNGE---
  561 ----NGGSITADEKE-------FYRDG----
  562 ----EDSFIEVDGEV-------VQRNGTFVF
  563 ----EDSFIEVDGEV-------VQRNGTFIF
  564 ----EDSYIEVDGER-------VQEDGTFVF
  565 ----EDSFIEVDGEV-------VQRNGTFRF
  566 ----EDSVIEVDGEV-------VQRDGTFRF
  567 ----EDSYIEVDGEV-------VQRDGTFQF
  568 ----AESRIEVDGEV-------VQRNGTFRF
  569 ----DDSVIEVDGEV-------VQRDGTFRF
  570 ----EDSFIEVDGEV-------VQEDGTFV-
  571 ----EDSFIEVDGEV-------VQEDGTFVF
  572 ----EDSFIEVDG------------------
  573 ----EDSIIEVDGEV-------VQRNGTFVF
  574 ----EDSTIEVDGEI-------IQRNGTFIF
  575 ----EDSVIEVDGEV-------VQRDGTFVF
  576 ----EDSVIEVDGEV-------VQRNGTFVF
  577 ----EDSVIEVDGEV-------VQENGAFIF
  578 ----EDSFIEVDGEI-------VQRNGTFVF
  579 ----EDSFIEVDG------------------
  580 ----SAGRIEFDGEV-------IQEGGQFVW
  581 ----EDATLSVDG------------------
  582 ----EDATLSVDGEV-------IQRDGVFRW
  583 ----EDGRLLIDGET-------VLEDGRFRW
  584 ----EGSRLEVDGET-------IQRDGVFRW
  585 ----EGSRLEVDGET-------IQKDGLFRW
  586 ----EDSYMEVDGEV-------VQRNGTFRW
  587 ----EDSYIEVDGEV-------VQRDGT---
  588 ----EDSRLEIDGEV-------VQRNGRFRW
  589 ----ADSRLE---------------------
  590 ----EDSRIEIDGDV-------VQRNGQFRW
  591 ----EESQLEIDGEV-------VQRDGQFRW
  592 ----EDSRLEIDGEV-------VQRNGTFRW
  593 ----EESRMDVDG------------------
  594 ----EDSRIEVDG------------------
  595 ----EESRMEVDG------------------
  596 ----SGAQIEIDDEI-------IQRNGRFKW
  597 ----DEGEIYLDGEL-------IFKNGQLLI
  598 ----HEGVVYIDGEP-------ILKDGKLLI
  599 SDGGCRGSLRIDDEW-------LIRDG----
  600 EY--GGGEIWFDDHL-------IRRDGRFLL
  601 DY--GGGEIYFDGEL----------------
  602 EY--GGGEIYFDDVL-------IRKDGVFVL
  603 EY--GGGEIYFDDRL-------IRKDGLFVI
  604 EF--GGGEIYFDDVL-------IRKDGRFVI
  605 DY--GGGEIYFDDVL-------IRKDGRFVI
  606 EY--GGGEIWFDDVL-------IRKDGRFVL
  607 EY--GGGEIYFDDVL-------IRKDGRFVI
  608 EY--GGGEIYFDDVL-------IRKDGRFVL
  609 EF--GGGEIYFDGIL-------IRKDGRFVL
  610 EY--GGGEIWFDDKL-------IRKDGLFV-
  611 EY--GGGEIWFDDRL-------VRKDGRFVL
  612 EY--GGGEIWFDDVL-------VRKDGLFV-
  613 EY--GGGEIYFDDLL-------VRKDGRFVL
  614 DY--GGGEMYFDGTL-------IRKDGRFVL
  615 EY--GGGAIYFDDVL-------IRQDGRFVI
  616 EF--GGGEMYFDSVL-------IRKDGIFVL
  617 EW--GGGEIWFDDRL-------IRKDGRFVV
  618 DW--GGGEIWFDDVL-------IRKDGRFVI
  619 EY--GGGEIYFDDQL-------IRKDGRFVI
  620 EY--GGGEIYFDEVL-------IRKDGRFVI
  621 DY--GGGEIYFDDVL-------IRKDGRFVI
  622 EY--GGGEIYFDGVL-------IRKDGRFVL
  623 EY--GGGEIYFDDVL-------IRKDGLFVI
  624 EY--GGGEIYFDDVL-------IRKDGRFTL
  625 EY--GGGEIYFDDVL-------IRKDGRFVV
  626 EY--GGGEIYFDDVL-------IRKDGRFVV
  627 EY--GGGEIYFDDVL-------IRKDGRFVV
  628 EY--GGGEIYFDDVL-------IRKDGRFVV
  629 EY--GGGEIYFDDVL-------IRKDGRFVV
  630 DY--GGGEIYFDDVL-------IRKDGIFVL
  631 DY--GGGEIYFDDVL-------IRKDGIFVL
  632 DY--GGGEIYFDDVL-------IRKDGIFVL
  633 DY--GGGEIYFDDVL-------IRKDGIFVL
  634 DY--GGGEIYFDDVL-------IRKDGIFVL
  635 DY--GGGEIWFDDVL-------IRKDGRFVL
  636 DY--GGGEIWFDDVL-------IRKDGRFVI
  637 EY--GGGNIYFDGEL-------IRENGRF--
  638 EY--GGGNIYFDGEL-------IRENGRF--
  639 EY--GGGEIYFDDVL-------VRKDGRFVV
  640 EY--GGGEIYFDGKL-------IRKDGRFVI
  641 EY--GGGEIYFDGKL-------IRKDGRFVI
  642 EY--GGGEIYFDGKL-------IRKDGRFVI
  643 EY--GGGEIYFDGKL-------IRKDGRFVI
  644 EY--GGGEIYFDGKL-------IRKDGRFVI
  645 EY--GGGEIYFDGKL-------IRKDGRFVI
  646 EY--GGGEIYFDGRL-------IRKDGRFVI
  647 EY--GGGEIYFDGVL-------IRKDGVFVL
  648 KY--GGGEIYFDDKL-------IRKDGLFV-
  649 KY--GGGEIYFDDKL-------IRKDGIFV-
  650 EY--GGGEIFFDGVL-------IRKDGRFVL
  651 EK--GGGEIYFNDVL-------IRKNGVFVL
  652 EY--GGGEIWFDDKL-------IRKDGLFVV
  653 EY--GGGEIWFDGVL-------IRKDGLFV-
  654 DY--GGGEIRFDGKL-------VRKDGLFV-
  655 EY--GGGEIWFDDVL-------IRKDGLFVV
  656 DY--GGGTIHFDGKL-------IREDGRFV-
  657 EW--GGGEVWFDGEL-------IRKEGMFI-
  658 DF--GGGELWFDDEL-------IRRDGLFIV
  659 EY--GGGEIWFDDVL-------IRKDGRFV-
  660 EY--GGGEIWFDDVM-------IRKDGLFVL
  661 EW--GGGEISIDGEL-------IRKDGRFV-
  662 AV--GGGEIWMDGVL-------VRKDGVFV-
  663 AA--GGGDIYLDGKL-------VRRNGLFTL
  664 EC--GGGRIEFDGQP-------IRVDGRFL-
  665 EF--GGGEIYFDDIL-------ISKDGKFV-
  666 ----DGGEIWFDDVL-------IQKNGLFV-
  667 ----KDGEIWFDDRL-------IQKQGLFV-
  668 ----GDGELWFDEHI-------IQKDGRFVH
  669 ----GDGELWFDDKL-------IQKDGRFVH
  670 ----GDGEIWFDNHL-------IQKDGLFVH
  671 ----GDGELWFDEIL-------IQKDGLFVH
  672 ----GDGELWFDDIL-------IQKDGLFVH
  673 ----KDGIIYLDGRK-------VMENGLWI-
  674 ----NTEDKRVTARLKDGSTVLIYESGRF--
  675 ----STEPKEVHAYLKSGEVLTIYRDGQFTI
  676 ----NTEPKRVRARLADGHEATVYENGQFL-
  677 ----NTEPKRVRARLADGHEVTVYENGQFL-
  678 ----NTEPKRVRAHLTDGRDVTLYEDGQF--
  679 ----NTEPKRVRAHLADGSDVTIYEDGQFTY
  680 ----STERKTVTATLADGQELIIYKDGEF--
  681 ----NTQQKTVTATLKGGEELVIYADGEF--
  682 ----NTQDKTVYAKLKDGSEVVIYKSGEF--
  683 ----NTEPKKVTAFLRGGTKTVIYEDGMFT-
  684 ----NTEAKRVTAYLRGGGKTVIYEQGMFT-
  685 ----NTEKKRVTANLESGKTVTIYENGKFPI
  686 ----NTEKKRVTAVLENGEKTTIYENGKFTY
  687 ----NTEKKTVTAHLKSGESLVIYKDGEF--
  688 ----NTEPKTVTAELTTGEKILIYENGEFCY
  689 ----ATTPRKVTAVTPGGTCVVIYEDGEFRL
  690 ----ATTPRKVTAATSGGKRIVVYEDGEF--
  691 ----ATTPRRVTAHLHGGKRTTIYEDGMFRI
  692 ----NTESKRVTALLRSGEKRTIYENGRFTL
  693 ----ATSNRTVTAYLKDGTSAVIYKDGQF--
  694 ----KEPTVLIDGKY-------LFKDGNLVI
  695 ----RNFDIWIDGRQI---------------



Key to colour-coding of features:
     Active site residue:           X
     Metal binding site:            X
Nature of evidence for features:
     Putative:              +
     Experimental:          #


MEROPS home Page created
 
© 2012 MRC/WTSI
Terms of use